Details for Arabidopsis Locus AT3G17530

Position : Chr3 ( 5`- 6000860 .. 6002282 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17530

Protein [Map View]
MMISDLPHDLESEILSRVPAKSLAKWKTTCKRWYALFRDPSFVKKNFDKAGGREMIVLMNSRVYSNSVNLQGINNRFDPS
MEVTGKLIKLNDSKGVDISAIFHCDGLILCTTTESTGLVVWNPCTGEIRCIKPRIFYRCNDRYALGYGNSKSSCHSYKIL
RSCCYYVDQNLSLMAAEFEIYDFSTDSWRDLGDITRDMIVYSSGVSLKGNTYWVSGSKEKGFFMRYFDFSKEVFGRLPLP
YQSFNANHTAALSAVGNEKIAVLQQKILAMSDEMRIWVTNKIDEAKDLSWSNFLLTVDYGKFNLPCLVNVTSFLLDEENK
VAVCSDVDTKDGLRSRIYIVGKDFYKEVFKDTRGSDNNWPLLLCYVPSLVSIQENIPNKAEENEIKGG*

DNA
ATGATGATTTCCGATCTTCCACACGATTTGGAATCGGAAATACTCTCTAGGGTTCCGGCGAAGTCCCTAGCAAAATGGAA
GACTACTTGCAAACGATGGTATGCTTTATTCAGAGATCCGAGTTTCGTCAAGAAGAACTTTGATAAAGCAGGAGGAAGGG
AAATGATAGTACTGATGAATTCTAGGGTTTATTCAAACAGCGTCAATCTCCAAGGGATTAACAATAGATTTGATCCAAGT
ATGGAGGTTACAGGTAAACTCATCAAGCTAAATGATTCAAAAGGTGTCGATATTTCTGCTATCTTTCACTGCGACGGTTT
GATATTATGCACTACGACGGAAAGCACTGGACTTGTGGTTTGGAACCCGTGTACCGGTGAAATTAGATGTATCAAACCCA
GAATATTTTACCGGTGTAATGATAGGTATGCTCTTGGTTACGGAAACAGCAAATCTTCTTGCCATAGCTACAAAATCTTG
AGGTCTTGCTGTTATTACGTCGACCAGAACCTCAGCCTCATGGCTGCTGAGTTTGAGATCTATGACTTTAGCACTGATTC
TTGGAGAGATCTTGGTGACATCACTCGTGACATGATCGTATATTCCAGTGGCGTGTCTTTGAAAGGAAATACTTACTGGG
TTTCTGGATCTAAAGAAAAAGGTTTTTTCATGCGGTATTTTGATTTTAGCAAAGAGGTATTTGGGCGTCTCCCTCTTCCA
TATCAGAGTTTTAATGCTAACCATACCGCGGCTCTATCAGCTGTTGGGAACGAAAAAATCGCCGTGTTGCAACAAAAAAT
TCTTGCAATGTCAGATGAGATGAGGATTTGGGTCACCAATAAGATTGATGAGGCCAAAGACTTGTCGTGGAGCAACTTTC
TCTTAACAGTGGATTATGGTAAATTTAATTTACCATGTCTAGTGAATGTGACAAGCTTCTTGTTGGACGAGGAGAATAAA
GTGGCAGTGTGTTCTGACGTAGACACGAAAGATGGACTTAGGAGCAGAATCTACATTGTGGGAAAGGATTTCTATAAAGA
AGTTTTTAAAGATACAAGGGGATCAGATAACAATTGGCCACTTCTCCTCTGTTATGTTCCTAGTTTGGTTAGCATTCAGG
AAAATATACCCAACAAGGCAGAAGAAAATGAAATCAAAGGAGGTTAG