Details for Arabidopsis Locus AT3G17470

Position : Chr3 ( 5`- 5979834 .. 5982115 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17470

Protein [Map View]
MSVIRPSPIPIPRCRSQVLHRRLYSIQLIQRRRRRWNPRSEVEDTAIESTARSPEAAGGKMVVELVGAFNEVTERMNSVW
LSTSSSRLLFKALKLSIPILQSLPLASDGRSPLSKALSLSIILADLQMDAEVISASILSEVVDANAISIYEVRDHIGTGT
AHLLHEIFRVKNIPFKVDVLDDETAASLRKFYLTYYDIRAVIMDLVSKLDEMRHLDHLPRYRQQILSLEVLKIYSPLAHA
VGANHLSLELEDISFRYLFPCSYIYLDSWLRGHENGSKPLIDVYKEQLHRSLKDDLVLAEMVNDVYIKGRYKSRYSMMKK
LLRDGRKPEEVNDVLGLRVILMPNSVVNDVEVGEKACYRTSEIIRSLWKEIPHRTKDYIARPKENGYRSLHMAVDVSDSD
QIRPLMEIQIRTMDMDGSANAGTASHSLYKGGLTDPKEAKRLKAIMLAAADLAAIRLKDISSNKHQSFKTTTNQRDRVFC
LLDKNGDGMISIEELMEVMEELGAPGEDAEEMMQLLDSNSDGSLSSDEFDTFQKQVEFMRKWEDRDNEYKSLLDEKLHDL
PHQDTTGLIQLYNKELEDRLSTH*

DNA
ATGTCTGTGATTCGTCCTTCTCCGATTCCAATTCCGAGATGCAGATCTCAGGTACTGCATCGTCGTCTTTATTCGATTCA
ATTGATTCAGCGACGACGTCGACGGTGGAATCCGAGGTCGGAGGTGGAGGATACTGCGATTGAATCGACGGCTCGGTCTC
CGGAGGCAGCGGGAGGGAAAATGGTGGTGGAGCTTGTTGGAGCTTTCAACGAAGTAACGGAGAGGATGAATTCGGTTTGG
TTGTCGACGTCTTCGTCTAGGTTACTCTTTAAAGCTCTCAAGCTCTCGATTCCGATTTTACAGTCTCTTCCTCTTGCCTC
TGATGGTCGCTCTCCTCTTTCTAAGGCTCTCTCACTCTCTATCATTCTCGCAGATCTCCAGATGGATGCAGAAGTTATCT
CGGCGAGTATATTGAGTGAGGTGGTGGACGCGAATGCGATATCTATATATGAAGTTAGAGACCATATTGGTACTGGAACT
GCTCATCTGCTTCATGAGATTTTTCGTGTGAAGAATATTCCTTTTAAAGTTGATGTGTTAGACGATGAAACTGCTGCTTC
ATTGAGAAAGTTCTATTTAACCTACTATGACATCAGAGCTGTGATTATGGATTTGGTTTCAAAGCTTGATGAGATGAGGC
ATTTGGATCACTTGCCAAGGTATCGCCAGCAGATTCTCTCTCTTGAAGTGTTGAAGATTTATTCTCCTTTAGCTCATGCG
GTGGGGGCTAATCACCTGTCACTTGAGCTCGAGGACATCTCTTTCCGTTATCTTTTTCCGTGTTCGTATATATACTTAGA
TTCATGGTTAAGAGGTCACGAGAACGGGTCTAAACCGTTGATAGACGTGTACAAAGAGCAGCTTCATCGGTCTTTGAAGG
ATGATTTGGTTTTGGCTGAAATGGTGAATGATGTATATATTAAAGGTCGGTATAAAAGTCGGTACAGCATGATGAAGAAG
CTCCTAAGAGATGGGCGTAAACCGGAAGAAGTGAACGATGTGCTTGGTCTACGGGTCATATTAATGCCTAATTCTGTAGT
AAACGATGTTGAAGTTGGCGAAAAAGCCTGTTACAGAACAAGTGAGATTATCCGGTCTTTGTGGAAGGAGATTCCGCATA
GAACAAAAGACTACATTGCTAGGCCAAAGGAAAATGGGTATAGGAGTTTACACATGGCAGTTGATGTTAGCGACAGCGAT
CAGATAAGACCTTTGATGGAGATACAAATACGGACAATGGATATGGATGGATCCGCTAATGCTGGAACAGCATCACATTC
TTTGTATAAAGGCGGTCTAACCGACCCAAAAGAGGCGAAGCGGCTTAAAGCGATAATGTTGGCAGCAGCGGATCTTGCAG
CGATTCGTCTCAAAGATATCTCATCAAATAAACACCAAAGCTTCAAGACAACAACGAACCAGAGAGACAGAGTGTTTTGC
CTTCTGGACAAAAACGGGGACGGAATGATCAGCATAGAGGAACTAATGGAAGTGATGGAAGAGCTTGGAGCTCCAGGTGA
AGACGCAGAGGAGATGATGCAGCTTCTTGACTCTAACAGCGATGGATCTCTTAGTTCAGACGAATTCGATACGTTTCAGA
AACAAGTAGAGTTCATGCGTAAATGGGAAGATAGAGATAACGAGTACAAGAGTCTTTTAGACGAGAAGCTTCATGATCTT
CCACATCAAGATACCACAGGTTTGATACAGTTATACAATAAAGAGCTTGAGGATCGTCTCTCAACCCATTAA