Details for Arabidopsis Locus AT3G17465

Position : Chr3 ( 5`- 5977817 .. 5979652 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17465

Protein [Map View]
MAAVPRGLLSRINQFLSIRSITPSSSESLPHCSSFFLIRRFSSDTGLMDGGGSDIIGAQTRIIEAKQGEMSSRSKRTGII
AVKCGMTALWDKWGKRIPISILWVDDNIVSQVKTVEKEGIFALQIGCGQKKPKHLSKAVVGHFRAQGVPLKRKLREFPVT
EDALLPVGTSLGVRHFVPGQYVDVTGITRGKGFQGCMKRHGFSGMPASHGASLSHRSGGSTGQRDAPGKVFKGRKMAGRM
GADQRTVKNVWVYKIDPARNLMWVRGQVPGAEGNFVFIKDAWCKKPDISKLPFPTYLAPEDEDPSELEPLVADLGEVDPF
MLAE*

DNA
ATGGCGGCCGTACCGAGAGGCCTCCTTTCTCGAATCAATCAGTTTCTATCAATACGGTCTATAACTCCTTCATCCTCTGA
ATCTCTTCCTCATTGTAGTAGCTTCTTTCTCATCCGACGATTCAGCTCCGATACTGGGTTGATGGACGGTGGTGGATCTG
ATATTATCGGGGCTCAGACCCGAATCATTGAGGCGAAACAAGGTGAGATGTCTAGTAGATCCAAGAGGACTGGGATCATC
GCGGTTAAGTGTGGGATGACTGCGCTCTGGGACAAATGGGGAAAGAGGATTCCGATTTCTATTCTTTGGGTTGATGATAA
TATCGTCTCTCAGGTTAAAACTGTTGAGAAAGAAGGCATTTTTGCGTTACAGATCGGATGTGGGCAAAAGAAACCGAAGC
ATTTGTCAAAAGCTGTGGTGGGGCATTTCAGAGCACAAGGTGTGCCGTTAAAGAGGAAGTTGAGGGAATTTCCTGTGACT
GAAGACGCTCTTCTTCCTGTTGGTACTTCACTCGGTGTCCGCCATTTTGTTCCGGGACAGTACGTTGATGTCACTGGGAT
CACTCGAGGAAAAGGTTTTCAGGGATGCATGAAAAGACATGGTTTCAGTGGAATGCCGGCATCACATGGTGCTTCATTGT
CCCATCGAAGCGGGGGTTCCACAGGGCAAAGAGATGCTCCTGGAAAGGTGTTCAAGGGCAGAAAGATGGCTGGGAGAATG
GGTGCAGATCAGAGGACAGTAAAGAACGTTTGGGTCTACAAGATCGATCCTGCGAGGAACCTCATGTGGGTGAGAGGACA
AGTTCCTGGTGCAGAAGGAAACTTTGTGTTCATAAAAGATGCATGGTGCAAGAAACCAGACATCTCAAAGCTTCCGTTTC
CAACTTACTTAGCTCCAGAAGATGAAGATCCATCAGAATTAGAACCGTTGGTTGCAGATCTTGGAGAAGTTGACCCATTT
ATGTTGGCAGAGTGA