Details for Arabidopsis Locus AT3G17430

Position : Chr3 ( 5`- 5965923 .. 5969233 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17430

Protein [Map View]
MAKMINKTLVLTYIYLLIYIILSSGVILYNKWVLSPKYFNFPLPITLTMIHMGFAGFVAFLLIRVFKVVAPVKMTFEIYA
TCVVPISAFFASSLWFGNTAYLHISVAFIQMLKALMPVATFIMAVVCGTDKPRCDVFSNMLLVSVGVVISSYGEIHFNIV
GTVYQVTGIFAEALRLVLTQVLLQKKGLTLNPITSLYYIAPCSFVFLALPWYVLEKPTMEVSQIQFNFWIFFSNALCALA
LNFSIFLVIGRTGAVTIRVAGVLKDWILIALSTVIFPESTITGLNITGYAIALCGVVMYNYIKVRDVKASQPTADSLPDR
INKEYKMEKKSSDKFNPNDSVEIPRVGGEVNDEEAPLITSRLSHIGRTQLGNHAA*

DNA
ATGGCAAAGATGATAAACAAGACGCTTGTATTAACTTATATCTACTTGCTGATCTACATTATACTTTCTTCAGGAGTTAT
ACTGTACAATAAGTGGGTTTTATCCCCAAAATACTTCAATTTTCCACTTCCTATAACGCTGACAATGATCCATATGGGGT
TTGCTGGATTCGTGGCTTTCCTTCTTATTCGTGTCTTCAAGGTTGTAGCTCCGGTTAAAATGACATTTGAAATATATGCA
ACCTGTGTGGTACCTATAAGTGCATTCTTTGCATCAAGTCTCTGGTTTGGAAATACTGCATATTTGCACATTTCTGTTGC
CTTCATTCAGATGCTGAAAGCTCTAATGCCAGTAGCGACATTTATCATGGCAGTTGTTTGTGGCACTGACAAACCAAGGT
GTGATGTGTTCTCGAACATGTTGCTGGTCAGTGTTGGAGTTGTGATATCTTCTTATGGGGAAATTCATTTCAACATAGTT
GGCACAGTCTATCAGGTGACAGGCATCTTTGCTGAAGCACTTAGACTGGTGCTAACTCAAGTTCTTCTCCAGAAGAAGGG
TTTGACATTGAACCCTATTACCAGCTTGTATTACATAGCTCCCTGCAGTTTTGTTTTTCTGGCCTTACCTTGGTATGTGT
TAGAGAAACCCACAATGGAAGTTTCACAGATCCAATTCAACTTCTGGATATTTTTCTCCAATGCTCTATGTGCTCTTGCC
TTGAACTTCTCCATATTCTTAGTCATTGGGAGAACAGGTGCAGTAACCATCCGGGTGGCTGGTGTTCTCAAAGACTGGAT
TCTTATAGCCCTCTCAACCGTCATTTTCCCCGAGTCCACAATCACTGGGTTGAATATCACTGGATACGCAATAGCGCTAT
GTGGTGTCGTCATGTACAATTACATAAAAGTAAGGGATGTGAAGGCGTCTCAACCAACAGCTGACAGTCTTCCAGATCGA
ATCAATAAGGAGTACAAGATGGAGAAGAAGTCTTCGGATAAATTCAATCCTAACGACAGTGTGGAGATCCCAAGAGTAGG
AGGAGAGGTAAACGACGAGGAAGCCCCTTTGATCACATCCCGGTTGTCTCATATTGGTCGGACGCAGCTCGGAAATCACG
CTGCTTAA