Details for Arabidopsis Locus AT3G17370

Position : Chr3 ( 5`- 5949006 .. 5949644 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17370

Protein [Map View]
MFKVMRESNMDMDTAGYNIIIHGLCKAGKFDEAGNIFTNLLISGLQPDVQTYNMMIRFSSLGRAEKLYAEMIRRGLVPDT
ITYNSMIHGLCKQNKLAQARKVSKSCSTFNTLINGYCKATRVKDGMNLFCEMYRRGIVANVITYTTLIHGFRQVGDFNTA
LDIFQEMVSNGVYSSSITFRDILPQLCSRKELRKAVAMLLQKSSMVSNNVTL*

DNA
ATGTTTAAGGTCATGCGGGAGAGTAACATGGATATGGATACAGCTGGTTATAACATCATCATCCATGGACTGTGCAAGGC
TGGTAAGTTTGACGAAGCAGGGAATATATTCACTAATCTCCTCATCAGTGGATTGCAACCTGATGTTCAAACTTACAATA
TGATGATCAGATTCAGCTCGTTAGGTAGGGCTGAAAAATTATATGCAGAGATGATCCGTAGAGGTCTAGTCCCCGATACT
ATAACCTATAACTCAATGATCCATGGACTCTGCAAGCAGAACAAACTAGCTCAGGCGAGAAAGGTATCCAAGAGCTGCTC
AACGTTTAATACACTCATTAATGGTTACTGTAAAGCAACAAGGGTTAAAGATGGGATGAATCTTTTCTGCGAGATGTATC
GAAGAGGAATAGTTGCTAATGTAATTACTTACACCACTTTGATTCATGGGTTTCGTCAAGTTGGTGATTTTAATACCGCC
TTAGACATTTTCCAGGAGATGGTTTCTAATGGTGTGTATTCTAGTTCGATAACGTTCCGTGATATTTTGCCACAGTTATG
CAGTAGGAAGGAACTAAGAAAGGCAGTGGCAATGCTACTGCAGAAGAGTAGCATGGTATCAAACAATGTAACCCTCTGA