Details for Arabidopsis Locus AT3G17350

Position : Chr3 ( 5`- 5934064 .. 5935303 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17350

Protein [Map View]
MTKLFFFFFSFLYTITTLTFPPLTTSAATSCRTLCGNIPINYPFGIDGGCGSPQYRGMFNCSTDLYFTTPSGSYKVQSID
YEKKTMVIFDPAMSTCSILQPHHDFKMADIQNTLIRPSYDTVFALFNCSNDSPVHNRYRNLCFNAAGHSCDELYSSCTSF
RIFNTTSPYGNNSTVHTTPYCCFTNYDTVRVMSMNILDCSHYTTVIDNGKMRGVGPLDWSYGIELSYSVTEIGCDRCRKS
GGTCGFDAETEIFLCQCSGSNNNPTRECGGGMTDRGGCSFTNINFITTLLTMFMSFIYTVL*

DNA
ATGACGAAGCTCTTCTTCTTCTTCTTCTCCTTCCTCTACACAATCACAACCCTAACATTTCCGCCATTAACAACCTCAGC
AGCAACATCATGCCGAACATTATGCGGCAACATCCCAATAAACTACCCGTTCGGCATCGACGGCGGTTGCGGATCTCCTC
AATACAGAGGAATGTTCAATTGCTCCACCGATCTATATTTCACCACTCCTTCCGGCAGCTATAAGGTCCAAAGCATCGAT
TACGAGAAGAAAACAATGGTAATCTTCGATCCTGCTATGTCTACTTGCTCGATTCTTCAGCCTCACCACGATTTCAAAAT
GGCGGATATTCAAAACACTCTTATTAGACCTTCGTACGACACCGTTTTCGCACTTTTCAACTGTTCCAACGATTCTCCTG
TTCATAATCGTTACCGGAATCTATGTTTTAATGCCGCCGGCCACTCTTGCGACGAGCTTTATAGCTCCTGTACTTCCTTT
CGAATCTTCAACACCACTTCTCCCTATGGTAACAACAGTACGGTTCATACGACGCCGTATTGCTGTTTCACTAACTACGA
TACGGTGCGGGTGATGAGTATGAACATTTTGGATTGCTCACATTACACGACGGTGATTGACAATGGAAAAATGAGAGGAG
TGGGGCCTTTGGATTGGTCCTATGGAATCGAGCTTTCGTACTCGGTAACGGAGATTGGCTGTGACCGTTGCCGAAAGTCA
GGTGGCACTTGTGGCTTTGACGCCGAGACGGAGATCTTTCTTTGCCAGTGTTCCGGTTCCAACAACAACCCTACGAGAGA
ATGTGGTGGAGGTATGACTGATCGAGGAGGCTGCAGTTTTACAAACATAAATTTTATAACGACTCTCTTGACTATGTTCA
TGTCTTTTATTTACACTGTTTTGTGA