Details for Arabidopsis Locus AT3G17300

Position : Chr3 ( 5`- 5907234 .. 5908893 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17300

Protein [Map View]
MPSLQTSLPPELANNVVRLYRECLRRAKFIGKQQHNTELVVGMVRQQFKKHMNETDPEKIQKLKDDAARGLINHMLFESA
KLTGGKVSQRS*

DNA
ATGCCGTCTCTGCAAACTTCTCTGCCTCCTGAACTCGCTAACAATGTGGTTAGGTTGTACCGAGAATGTCTTCGTAGAGC
TAAATTTATTGGTAAGCAGCAACACAACACTGAGCTAGTGGTTGGTATGGTGAGGCAACAATTTAAGAAACACATGAATG
AGACAGACCCTGAGAAGATTCAGAAGCTTAAAGATGATGCTGCTCGGGGACTCATCAATCACATGTTGTTTGAGTCAGCG
AAGCTGACAGGAGGCAAGGTTAGCCAGAGATCCTGA