Details for Arabidopsis Locus AT3G17250

Position : Chr3 ( 5`- 5892561 .. 5894446 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17250

Protein [Map View]
MRTSKASVTQTWLLYTQLCLWKDLIIRYVRQIIRRAKSMLFSQNMVADSAEISVIDVKSHLSVAKDPSNFQIAEIRIHDS
ICIDIPSSEETPLLESIKSCSATTIEEHVTEFVPNISSGSYADKGDYREYMEDEHICIDDLSDHLGSSFYRFPVPMAFYG
VFDGHGGSDASQYIKENAMSLFFEDAVFRQSPSVVDSLFLKELETSHREAYRLADLAMEDERIVSSSCGTTALTALVIGR
HLMVANVGDCRAVLCRKGKAVDMSFDHKSTFEPERRRVEDLGGYFEGEYLYGDLAVTRALGDWSIKRFSPLGESLSPLIS
DPDIQQMILTEEDEFLIMGCDGVWDVMTSQYAVTFVRQGLRRHGDPRRCAMELGREALRLDSSDNVTVVVICFSSSPAPQ
RRRIRFCVSDEARARLQTMLEG*

DNA
ATGCGTACAAGCAAAGCTTCAGTGACCCAAACATGGCTGCTTTACACACAGCTTTGTCTTTGGAAAGATCTCATAATCCG
CTATGTCCGTCAGATCATAAGAAGAGCAAAATCGATGCTTTTCAGTCAAAACATGGTCGCTGATTCCGCCGAGATCAGTG
TTATCGATGTCAAGTCTCATCTCTCCGTTGCGAAAGATCCTAGTAACTTTCAGATTGCCGAAATTCGAATTCATGATTCA
ATTTGTATTGATATTCCGAGCTCTGAAGAAACGCCTCTTTTAGAATCGATCAAGAGTTGTTCTGCAACTACTATTGAAGA
GCATGTTACTGAGTTTGTACCAAATATAAGCTCAGGGAGTTATGCAGATAAGGGTGACTACCGGGAGTACATGGAAGATG
AACACATATGCATAGACGACCTTTCAGATCATCTTGGGTCTTCCTTTTACAGATTTCCGGTGCCTATGGCTTTCTACGGT
GTGTTTGATGGCCATGGTGGATCTGACGCATCACAGTATATAAAAGAGAATGCTATGAGCTTGTTCTTTGAAGATGCTGT
TTTTCGACAATCGCCCTCTGTTGTGGACTCTCTTTTCTTGAAAGAACTGGAGACATCTCACCGGGAAGCTTATAGGCTTG
CTGATCTTGCAATGGAGGACGAAAGAATAGTTAGTAGTTCGTGCGGAACAACCGCATTGACTGCTCTTGTAATCGGAAGA
CATTTAATGGTCGCTAATGTTGGTGATTGTCGTGCGGTGCTCTGCAGAAAAGGAAAAGCTGTTGATATGTCATTTGATCA
CAAATCTACATTTGAGCCAGAACGGAGACGAGTAGAGGATTTAGGAGGGTACTTTGAAGGCGAGTATCTCTATGGTGACC
TTGCTGTTACAAGAGCTCTTGGAGACTGGTCAATAAAGAGGTTTTCACCCCTTGGTGAATCTTTGTCACCTCTGATCTCA
GACCCGGACATTCAACAGATGATTCTAACTGAGGAAGACGAGTTCTTGATTATGGGATGTGACGGTGTTTGGGACGTGAT
GACAAGCCAGTATGCTGTTACTTTCGTCAGGCAAGGACTTAGGAGACACGGTGATCCTAGAAGGTGCGCTATGGAACTTG
GAAGGGAAGCGTTAAGGCTAGACTCATCAGATAACGTTACAGTGGTGGTCATCTGCTTCTCATCATCCCCAGCTCCTCAG
AGAAGAAGGATACGGTTCTGTGTTTCCGATGAAGCTCGAGCCCGGTTACAGACAATGCTAGAAGGCTAA