Details for Arabidopsis Locus AT3G17220

Position : Chr3 ( 5`- 5883328 .. 5883849 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17220

Protein [Map View]
MAAYLTNRVLMSSLMFFVMTGSLNAQVADIKAICGKAKNQSFCTSYMKSNPKTSGADLQTLANITFGSAQTSASEGFRKI
QSLVKTATNPTMKKAYTSCVQHYKSAISSLNDAKQSLASGDGKGLNIKVSAAMEGPSTCEQDMADFKVDPSAVKNSGDFQ
NICGIVLVISNMM*

DNA
ATGGCAGCATACCTGACGAACAGAGTTTTAATGTCTTCTCTGATGTTTTTTGTAATGACTGGTTCTTTGAACGCACAAGT
GGCAGACATAAAAGCGATATGTGGAAAAGCGAAAAACCAATCCTTCTGTACGAGCTACATGAAATCCAACCCAAAGACCT
CAGGTGCTGATCTTCAAACGCTTGCAAATATCACATTTGGTTCTGCACAAACAAGTGCATCAGAAGGTTTCAGGAAAATT
CAATCTCTAGTCAAGACAGCAACCAACCCCACTATGAAGAAAGCATACACCTCATGTGTACAACATTATAAGAGTGCAAT
AAGCAGTCTCAATGATGCTAAGCAGAGCCTGGCGTCAGGCGATGGCAAAGGGTTGAACATTAAGGTTTCAGCAGCTATGG
AAGGACCTTCAACATGTGAACAAGACATGGCGGATTTCAAAGTTGATCCTTCAGCTGTGAAGAACAGTGGTGATTTTCAG
AATATTTGTGGCATTGTACTTGTCATCTCAAACATGATGTGA