Details for Arabidopsis Locus AT3G17150

Position : Chr3 ( 5`- 5847258 .. 5848195 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17150

Protein [Map View]
MHYQIKTMMKLFSIFVVFMQIQVALSSQPIRYATEPKPIQELCKFNINPSLCVSTLNLDPRSKNSNLRELAWISIDATSN
KVNKMLNYLISVSKNIKDREDLKKYKTCIDDYGTAARRFLPAALDDLKAGFFSLAKSDMESVVSIPDHCEAQFGGSSPLT
GRNKATHDIANMTADIIRYLFGNN*

DNA
ATGCACTATCAAATAAAAACAATGATGAAATTATTCTCTATTTTTGTCGTATTTATGCAAATCCAAGTAGCATTGTCGTC
TCAACCAATTCGGTATGCTACGGAACCTAAGCCCATACAAGAACTCTGCAAATTTAACATTAATCCAAGCCTCTGCGTCT
CTACTCTCAATCTTGATCCTAGAAGCAAGAACTCAAATTTACGAGAGCTTGCGTGGATCTCTATCGATGCGACTTCAAAC
AAAGTCAACAAAATGTTAAACTATCTCATCTCCGTCTCTAAGAACATCAAAGACCGTGAAGACTTAAAGAAGTACAAAAC
TTGCATTGATGACTATGGCACGGCGGCTCGTAGGTTTTTACCGGCGGCGTTGGATGATCTTAAAGCTGGGTTCTTTTCTC
TAGCGAAGTCTGATATGGAAAGTGTTGTGTCGATACCCGATCATTGTGAGGCGCAATTCGGTGGGAGTTCACCGTTGACG
GGACGTAACAAAGCCACTCATGATATCGCTAATATGACTGCTGACATCATAAGATATCTTTTTGGCAATAATTAA