Details for Arabidopsis Locus AT3G17130

Position : Chr3 ( 5`- 5844495 .. 5845046 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17130

Protein [Map View]
MKRSSTVTSLPCLSLFLLLLLPSVVQSSDDLIDKICQATPFCDLCEASLRPFSPSPSDPKSLGAAMASVVLGNMTDTLGY
IQSLIKHAHDPAAERALAQCAELYRPVVKFNIPQAMEAMQGGKFGFAIYVLGDAEKQTDSCQKGITNAGADDESSVAVTA
RNKLVKNLCDVAISVLKSLMNGL*

DNA
ATGAAAAGATCATCCACCGTCACATCATTACCGTGTCTCTCCCTCTTTCTCCTTCTGCTTCTGCCGTCGGTAGTCCAATC
CTCCGACGACCTTATCGACAAAATATGCCAAGCAACGCCATTCTGCGACCTATGTGAAGCCTCTCTTCGTCCATTCTCTC
CGTCACCTTCTGATCCCAAATCCTTAGGTGCCGCTATGGCCAGCGTCGTGCTCGGAAACATGACCGATACTTTAGGATAC
ATCCAATCGCTGATCAAACATGCTCACGATCCTGCGGCAGAGCGCGCGCTGGCTCAGTGCGCTGAGCTGTACCGGCCGGT
GGTCAAGTTTAATATTCCTCAGGCGATGGAGGCAATGCAGGGCGGCAAATTCGGCTTTGCGATATATGTGCTCGGAGACG
CCGAGAAGCAGACTGATTCTTGTCAGAAAGGAATCACGAACGCCGGCGCCGACGATGAAAGCTCGGTGGCTGTTACGGCT
AGAAACAAGCTAGTTAAAAATCTTTGTGACGTGGCGATTTCTGTGCTTAAGTCTCTGATGAATGGTCTTTAA