Details for Arabidopsis Locus AT3G17100

Position : Chr3 ( 5`- 5831194 .. 5832419 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17100

Protein [Map View]
MESISPVSNQLLQPTTTSSNSDRSRRKRKKKSSPSSVEKSPSPSISLEKWRSEKQQQIYSTKLVHALRELRISQQPSSSS
SSSIPRGGRAVREVADRALAVAARGKTLWSRAILSKAVKLKFRKHKRQRISNPTTTTLTTGSIRSKKQRATVLRLKAKGL
PAVQRKVKVLSRLVPGCRKQSLPVVLEETTDYIAAMEMQIRTMTAILSAVSSSPPPPTPGHEGGQTHMLG*

DNA
ATGGAGTCTATATCTCCGGTATCGAATCAGCTTCTTCAGCCGACGACGACGAGCTCTAATTCCGATCGCTCTCGTCGTAA
GCGTAAGAAGAAATCATCGCCATCATCGGTTGAGAAATCTCCATCTCCGTCAATATCGTTGGAGAAATGGAGATCGGAGA
AGCAGCAACAGATCTACTCAACGAAGCTAGTTCATGCTTTAAGAGAGCTACGAATCAGCCAACAACCATCTTCATCATCA
TCTTCTTCGATTCCACGTGGAGGTAGAGCCGTACGTGAAGTCGCCGATAGAGCTTTAGCAGTTGCGGCGAGAGGTAAAAC
GTTATGGAGTCGAGCGATACTTTCAAAAGCTGTAAAACTCAAATTCAGGAAACACAAACGCCAGAGAATCTCTAATCCGA
CGACGACGACGTTAACCACCGGGAGTATCAGGTCAAAGAAACAGAGAGCGACGGTTTTGAGGCTTAAGGCTAAAGGTTTG
CCAGCTGTACAGAGGAAAGTGAAAGTACTGAGCCGGTTAGTTCCCGGTTGCCGTAAACAATCATTACCGGTGGTTTTAGA
AGAAACCACTGATTATATAGCTGCGATGGAGATGCAGATTCGTACTATGACTGCGATTCTCTCCGCCGTTAGTTCTTCTC
CTCCGCCGCCAACGCCAGGTCACGAAGGGGGACAAACACACATGCTTGGTTAG