Details for Arabidopsis Locus AT3G17080

Position : Chr3 ( 5`- 5825289 .. 5825867 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17080

Protein [Map View]
MGSLETCLLFFVMVMFMSAIMSRASTSVVIYNDLGGGLPLRHHCKSREDDLGYQSLAPGRSWSFGFTPDIFGRTLFYCRF
SWGAESHIFDIYKQSRDKEFQEFGCKKCEWKIRKNGPCKFYKKTGMFDHCYSWD*

DNA
ATGGGTTCTCTTGAGACATGCTTACTTTTCTTTGTAATGGTTATGTTTATGAGTGCAATTATGTCTCGAGCCTCGACGAG
TGTAGTGATTTATAATGATCTTGGAGGTGGTTTGCCACTACGGCACCACTGCAAATCAAGAGAGGATGATCTTGGATACC
AGAGTTTAGCACCAGGTAGATCGTGGTCGTTTGGATTTACACCGGATATTTTTGGCCGGACTTTGTTTTACTGTCGTTTT
AGTTGGGGAGCTGAGAGTCATATATTTGATATCTACAAACAGAGTAGAGACAAAGAATTTCAAGAGTTTGGTTGCAAAAA
ATGCGAATGGAAAATACGGAAAAATGGACCTTGCAAGTTTTATAAGAAGACCGGCATGTTTGATCATTGCTATTCTTGGG
ATTAA