Details for Arabidopsis Locus AT3G17070

Position : Chr3 ( 5`- 5820961 .. 5823199 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17070

Protein [Map View]
MKPKSKVAESTAASCFLVMSLLCSCIIGDQMETNNEGLSYSYYEKTCPKVEEIVRSSLSSMFILDPTSPAALLRLMFHDC
QVQGCDASILLEPIRDQQFTELDSAKNFGIRKRDLVGSIKTSLELECPKQVSCSDVIILAARDAVALTGGPLISVPLGRK
DSLSTPSKHVADSELPPSTADVDTTLSLFANKGMTIEESVAIMGAHTIGVTHCNNVLSRFDNANATSENMDPRFQTFLRV
ACPEFSPTSQAAEATFVPNDQTSVIFDTAYYDDAIAGRGNLRIDSEIGADPRTRPFVEAFAADQDRFFNAFSSAFVKLSS
YKVLTGNEGVIRSVCDKVD*

DNA
ATGAAACCAAAGAGCAAAGTTGCAGAATCTACAGCTGCATCATGTTTTCTCGTCATGAGCTTGTTATGCAGCTGCATTAT
TGGTGACCAAATGGAGACTAATAATGAAGGCTTGTCTTACAGTTACTACGAGAAAACTTGTCCCAAAGTCGAAGAGATAG
TGAGATCTTCACTTTCATCAATGTTTATACTTGATCCTACTTCTCCTGCAGCCTTGCTAAGGCTTATGTTTCATGACTGC
CAAGTTCAGGGATGTGACGCATCAATCCTACTCGAGCCAATTAGAGACCAACAGTTCACCGAGCTTGATTCAGCCAAGAA
CTTCGGAATCAGAAAGAGGGACCTGGTTGGCTCTATCAAAACCTCACTAGAGCTTGAGTGTCCCAAGCAAGTCTCATGCT
CTGACGTCATCATCCTCGCCGCCAGAGACGCCGTGGCTCTCACGGGAGGCCCACTCATCTCCGTGCCATTAGGACGAAAA
GACTCCCTCTCCACTCCAAGCAAACACGTGGCAGACTCTGAGCTTCCTCCCTCCACTGCTGACGTTGACACTACCTTAAG
CCTATTCGCTAACAAAGGCATGACCATCGAAGAGTCCGTGGCCATCATGGGTGCACATACGATAGGAGTCACACATTGCA
ACAACGTATTATCGCGTTTCGATAACGCAAACGCGACAAGCGAGAACATGGATCCACGTTTTCAAACGTTCTTGCGTGTT
GCTTGTCCAGAGTTTTCTCCAACTTCTCAAGCTGCGGAAGCCACATTTGTCCCCAACGATCAAACTTCGGTGATCTTCGA
TACAGCTTATTACGATGATGCCATCGCGGGACGTGGCAATCTTAGGATTGACTCGGAGATTGGAGCTGATCCACGTACAC
GTCCATTTGTGGAAGCGTTTGCAGCTGATCAAGACCGTTTCTTCAACGCCTTCTCTTCCGCGTTTGTAAAATTGTCGTCT
TACAAAGTGTTAACCGGGAATGAAGGAGTAATTAGAAGCGTGTGTGACAAGGTTGATTGA