Details for Arabidopsis Locus AT3G17060

Position : Chr3 ( 5`- 5816672 .. 5818498 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17060

Protein [Map View]
MGHRTRMILVLTLVVMSIWGSDASAMQKTKFDAPLLTEKIATNRSIIVDIEGKGDYTSVQKAIDAVPVGNSNWIIVHVRK
GIYKERVHIPENKPFIFMRGNGKGKTVIESSQSSVDNVASATFKVEANHFVAFGISIRNDAPVGMAFTSENQSVAAFVAA
DKVAFYHCAFYSLHNTLFDNKGRHYYHECYIQGSIDFIFGRATSIFNNCEIFVISDKRVKPYGSITAHHRESAEEKTGYV
FIRGKVYGIDEVYLGRAKGPYSRVIFAKTYLSKTVVPDGWTNWSYHGSTQNLYHGEYKCHGPGAERQKRSDWAKDLTKQE
VESFLSIDFIDGTSWLPVWLQEKF*

DNA
ATGGGTCATCGAACAAGAATGATCCTTGTCCTAACCCTAGTTGTAATGTCCATATGGGGTTCGGACGCATCAGCAATGCA
AAAGACGAAATTCGACGCCCCACTTTTGACTGAAAAAATCGCGACAAATAGATCGATAATTGTAGATATCGAAGGCAAAG
GAGACTACACTTCGGTTCAGAAAGCCATCGATGCTGTCCCTGTTGGTAACTCTAATTGGATTATTGTCCATGTCCGTAAA
GGAATCTACAAGGAGAGAGTGCACATTCCGGAGAACAAGCCGTTCATATTCATGAGGGGTAATGGAAAAGGAAAAACGGT
GATCGAATCTTCGCAAAGTTCGGTCGACAATGTTGCTTCAGCTACTTTCAAAGTCGAGGCTAATCACTTTGTCGCTTTTG
GTATCAGCATCCGAAATGATGCACCTGTCGGAATGGCATTCACATCTGAGAACCAATCGGTGGCAGCGTTTGTGGCTGCT
GACAAAGTAGCGTTTTACCATTGTGCGTTCTACAGCTTACACAACACTTTGTTTGATAACAAAGGTAGACATTACTACCA
TGAGTGTTACATCCAAGGCTCCATAGACTTCATCTTCGGTCGCGCAACTTCCATTTTCAACAATTGTGAGATATTTGTGA
TATCAGACAAGAGGGTGAAACCGTATGGGTCAATCACAGCACACCATAGGGAAAGCGCAGAGGAAAAAACGGGTTACGTG
TTCATAAGAGGCAAAGTGTACGGAATTGATGAGGTTTACTTGGGCCGAGCCAAAGGACCTTATTCTCGAGTCATCTTTGC
CAAGACTTACTTGTCCAAGACCGTTGTGCCTGATGGTTGGACAAACTGGAGTTACCATGGCTCGACCCAGAATCTATACC
ATGGGGAGTATAAATGTCATGGACCAGGAGCTGAGAGGCAAAAGAGATCTGACTGGGCCAAAGATCTTACCAAACAAGAA
GTTGAGTCTTTCTTGTCCATTGATTTTATTGATGGCACTTCTTGGCTCCCTGTTTGGCTTCAGGAAAAGTTTTAG