Details for Arabidopsis Locus AT3G17040

Position : Chr3 ( 5`- 5809266 .. 5812678 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17040

Protein [Map View]
MHFFFVPNSSSSSPSPANTSSFSLSFLTPQIPENLCKSPTKIHIGTHGISGQSFLSHPTFSSKNTYLYAVVDRSSSGVFS
PQKESANGEGEESNTEEGVLVVRRPLLENSDKESSEEEGKKYPARIDAGLSNIAKKMPIFEPERSESSSSSSAAAAARAQ
ERPLAVNLDLSLYKAKVLARNFRYKDAEKILEKCIAYWPEDGRPYVALGKILSKQSKLAEARILYEKGCQSTQGENSYIW
QCWAVLENRLGNVRRARELFDAATVADKKHVAAWHGWANLEIKQGNISKARNLLAKGLKFCGRNEYIYQTLALLEAKAGR
YEQARYLFKQATICNSRSCASWLAWAQLEIQQERYPAARKLFEKAVQASPKNRFAWHVWGVFEAGVGNVERGRKLLKIGH
ALNPRDPVLLQSLGLLEYKHSSANLARALLRRASELDPRHQPVWIAWGWMEWKEGNTTTARELYQRALSIDANTESASRC
LQAWGVLEQRAGNLSAARRLFRSSLNINSQSYVTWMTWAQLEEDQGDTERAEEIRNLYFQQRTEVVDDASWVTGFLDIID
PALDTVKRLLNFGQNNDNNRLTTTLRNMNRTKDSQSNQQPESSAGREDIETGSGFNLDVFLRSKLSLDPLKLDVNLDSKR
LERFTRGRINGA*

DNA
ATGCACTTCTTCTTCGTGCCGAATTCTTCGTCTTCATCTCCTTCTCCGGCCAATACTTCTTCATTCTCGCTATCGTTTCT
CACTCCTCAAATTCCTGAGAATCTCTGTAAGTCACCGACGAAAATCCACATCGGAACTCATGGAATCTCCGGTCAATCGT
TTCTCAGTCATCCTACTTTCTCATCTAAGAACACGTATCTGTATGCAGTCGTCGACAGGTCTTCTTCAGGTGTATTTTCG
CCGCAAAAGGAATCTGCCAATGGCGAGGGAGAGGAATCTAACACGGAGGAGGGAGTATTAGTAGTTCGACGGCCGTTGTT
GGAGAATTCCGATAAGGAATCTAGTGAGGAAGAGGGAAAAAAGTATCCAGCGAGGATCGATGCTGGTCTGAGTAATATAG
CTAAGAAGATGCCGATATTTGAGCCGGAGAGATCGGAATCGTCGTCGTCATCTTCAGCCGCTGCTGCTGCAAGAGCTCAA
GAGAGACCGCTTGCGGTGAATTTGGACTTGTCTCTGTACAAAGCAAAGGTTTTGGCGAGAAATTTCAGATACAAAGACGC
CGAGAAGATTCTAGAGAAGTGCATAGCTTACTGGCCGGAGGATGGGAGACCGTACGTGGCATTGGGGAAGATACTAAGCA
AACAATCCAAGTTAGCTGAAGCTCGAATCCTGTATGAAAAAGGGTGTCAATCTACACAAGGAGAGAATTCATACATTTGG
CAGTGTTGGGCTGTCCTGGAAAACAGGTTGGGAAATGTAAGAAGAGCCAGGGAGTTGTTTGATGCAGCCACGGTGGCTGA
CAAGAAGCATGTAGCAGCCTGGCATGGATGGGCAAACCTGGAGATAAAACAAGGAAATATAAGTAAAGCAAGGAATCTTC
TAGCCAAAGGCCTCAAGTTTTGTGGCAGAAACGAGTATATCTACCAAACACTTGCCTTGTTGGAGGCCAAAGCTGGCCGG
TATGAACAGGCAAGGTACCTGTTCAAGCAGGCGACTATATGCAATTCAAGGAGTTGTGCCAGTTGGTTGGCATGGGCACA
GTTGGAAATACAGCAGGAAAGATACCCAGCTGCTAGAAAGCTTTTTGAGAAAGCTGTCCAGGCAAGCCCCAAGAATAGAT
TTGCGTGGCACGTATGGGGGGTGTTTGAAGCTGGAGTAGGTAATGTTGAGCGTGGAAGAAAGCTCCTGAAGATAGGTCAT
GCGCTAAATCCTAGAGACCCTGTTCTCCTTCAGTCCCTTGGCTTACTGGAGTACAAACATTCATCTGCTAATCTTGCCCG
GGCTTTACTAAGGAGAGCATCAGAGCTCGATCCTAGACATCAACCTGTTTGGATTGCTTGGGGTTGGATGGAATGGAAAG
AAGGAAACACAACAACAGCTAGAGAACTTTACCAAAGAGCTCTCTCCATTGATGCAAATACCGAAAGTGCTTCTCGCTGT
CTACAGGCGTGGGGAGTTCTCGAGCAGAGAGCAGGAAACTTATCAGCAGCAAGAAGATTATTCAGATCTTCATTGAACAT
TAACTCACAAAGCTACGTTACATGGATGACATGGGCACAACTTGAGGAAGATCAAGGAGACACCGAACGTGCTGAAGAAA
TCCGTAACCTCTATTTTCAACAACGCACAGAGGTTGTTGATGATGCTTCGTGGGTCACAGGATTCTTGGATATTATTGAC
CCGGCTTTAGACACCGTTAAAAGGCTCTTGAACTTTGGTCAGAACAATGACAACAACAGATTAACTACTACTCTTAGAAA
CATGAATAGAACCAAAGATAGCCAATCCAATCAGCAACCCGAGAGCTCTGCGGGACGCGAGGACATTGAAACTGGGAGCG
GGTTTAACCTCGATGTATTTTTACGCTCGAAGCTGTCGTTGGATCCTTTGAAGCTGGACGTTAATCTTGATTCTAAGAGG
TTAGAGAGATTCACTAGAGGAAGAATAAATGGTGCTTGA