Details for Arabidopsis Locus AT3G17020

Position : Chr3 ( 5`- 5802536 .. 5804157 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17020

Protein [Map View]
MAESGGRRIGVAVDFSDCSKKALSWAIDNVVRDGDHLILITIAHDMNYEEGEMQLWETVGSPFIPMSEFSDAAVMKKYAL
KPDAETLDIVNTAARKKTITVVMKIYWGDPREKICAAAEQIPLSSLVMGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK
AHI*

DNA
ATGGCGGAGAGTGGTGGACGAAGGATCGGAGTGGCGGTGGATTTCTCGGACTGCAGTAAGAAGGCTCTGAGCTGGGCGAT
CGATAACGTGGTTCGCGACGGAGATCATCTGATCCTAATCACTATTGCTCACGATATGAATTACGAGGAAGGCGAGATGC
AGCTCTGGGAGACCGTTGGATCACCTTTTATTCCTATGAGTGAATTCTCTGACGCTGCTGTGATGAAAAAGTATGCATTG
AAGCCAGATGCTGAAACCCTTGACATTGTCAATACTGCCGCTAGGAAGAAAACGATTACAGTAGTGATGAAGATATATTG
GGGAGATCCTCGTGAGAAGATTTGTGCAGCAGCTGAACAGATTCCTCTCTCAAGCCTTGTGATGGGTAACAGAGGCCTTG
GTGGTCTTAAGAGGATGATTATGGGAAGTGTAAGCAACCATGTTGTCAACAACGTTGCATGCCCTGTGACCGTTGTCAAG
GCTCACATCTGA