Details for Arabidopsis Locus AT3G17010

Position : Chr3 ( 5`- 5800460 .. 5802468 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G17010

Protein [Map View]
MGKSSNIVFDRIKEERQMLSFFKIFQRADLSSDCMRALPYSFISKVSEKDFSYKMVIRAQWGKTWDVEVSKNPTYYYIET
RGWDLFVSDNALGQNEFITFTHRGNMVFHVNIYEQNGLEMRKPRKFQTMGPSSGIKKEEGENSLIDVKKEEESDESPGRA
EFLVRKKKTEDSKSSKKKMTRNKVKKKSKSKSKQVLDGVPEFKITIRKSYLKFLAIPKHFVDDHIPNKSKIFTIRHPNGG
SWKVLCLVREIRTIFSGGYSKLAREFPLMVGDKCTFKLIKPFEFVLLTSKKNREKMDQCMID*

DNA
ATGGGTAAGAGTAGTAACATAGTTTTTGATCGGATTAAAGAAGAACGGCAGATGTTGAGCTTTTTCAAGATTTTTCAGAG
GGCAGATCTATCCTCTGACTGCATGAGAGCGCTTCCTTACAGCTTCATAAGCAAAGTCTCTGAGAAAGACTTCTCTTACA
AGATGGTTATAAGAGCGCAATGGGGAAAGACATGGGATGTAGAAGTCTCCAAGAACCCGACATACTACTACATTGAGACG
CGTGGATGGGATCTGTTTGTGAGTGACAATGCTTTAGGACAAAACGAGTTCATTACCTTCACTCACAGAGGAAATATGGT
CTTTCATGTCAACATCTACGAGCAGAATGGCTTAGAGATGCGTAAACCTCGAAAATTCCAGACGATGGGTCCTTCTAGTG
GGATCAAGAAAGAAGAAGGAGAGAACAGCCTCATAGATGTGAAGAAGGAAGAGGAAAGTGATGAATCTCCGGGACGAGCT
GAGTTCCTAGTTAGAAAGAAGAAGACTGAGGATTCCAAATCATCAAAGAAGAAGATGACGAGAAACAAAGTGAAGAAGAA
GAGCAAGAGCAAGAGCAAGCAAGTGCTGGATGGTGTTCCAGAGTTCAAAATCACCATAAGGAAATCATACCTCAAGTTCC
TGGCAATACCAAAACATTTTGTGGATGATCATATCCCGAATAAGTCTAAGATTTTCACGATTCGTCACCCGAATGGTGGT
TCATGGAAGGTGCTTTGCTTGGTGAGGGAGATTCGGACAATCTTCTCAGGTGGATACTCGAAATTGGCAAGAGAGTTCCC
TTTGATGGTTGGTGACAAATGCACCTTTAAGCTTATCAAACCCTTCGAGTTTGTCCTTCTTACCTCCAAGAAGAACAGAG
AGAAGATGGATCAGTGCATGATCGATTGA