Details for Arabidopsis Locus AT3G16990

Position : Chr3 ( 5`- 5795834 .. 5796850 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16990

Protein [Map View]
MEKRGVIDTWIDKHRSIYTAATRHAFVVSIRDGSVDLSSFRTWLGQDYLFVRRFVPFVASVLIRACKDSGESSDMEVVLG
GIASLNDEIEWFKREGSKWDVDFSTVVPQRANQEYGRFLEDLMSSEVKYPVIMTAFWAIEAVYQESFAHCLEDGNKTPVE
LTGACHRWGNDGFKQYCSSVKNIAERCLENASGEVLGEAEDVLVRVLELEVAFWEMSRGGQ*

DNA
ATGGAGAAGAGAGGGGTGATCGACACATGGATTGATAAGCACCGTTCGATCTATACGGCGGCTACACGTCATGCTTTTGT
CGTCTCGATCCGTGACGGATCCGTTGATCTCTCGTCCTTCAGAACTTGGCTGGGGCAAGATTATCTGTTCGTGAGGAGGT
TTGTGCCGTTTGTAGCGAGTGTGTTGATCAGAGCTTGCAAAGATTCCGGCGAGAGTTCCGATATGGAAGTGGTGCTTGGT
GGTATAGCATCGTTGAATGATGAAATAGAATGGTTTAAAAGAGAAGGATCGAAATGGGATGTTGATTTCTCGACCGTTGT
GCCTCAAAGAGCTAATCAAGAATATGGCAGGTTTTTGGAAGATCTGATGAGCAGTGAGGTGAAGTATCCGGTGATTATGA
CAGCTTTCTGGGCAATTGAAGCAGTGTATCAAGAGAGCTTTGCTCATTGTTTAGAAGACGGGAACAAAACTCCGGTGGAG
CTTACCGGTGCTTGTCATCGTTGGGGGAATGACGGGTTTAAACAGTATTGTTCGTCTGTCAAGAACATTGCCGAACGTTG
TCTGGAGAATGCCTCCGGTGAGGTGCTCGGTGAAGCTGAAGATGTACTTGTACGAGTTCTTGAACTAGAGGTTGCCTTCT
GGGAGATGAGCCGTGGAGGACAGTAG