Details for Arabidopsis Locus AT3G16960

Position : Chr3 ( 5`- 5791812 .. 5792264 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16960

Protein [Map View]
MGALAELVALIIVMCASVTMSLAQNPMASPPSVENPNTTVVIHNALSGYWPMAYHCASKDVDFGLRRMLAERDQESAMFG
CKRCEWKIREEGPCKLNKKTGMFDLCPPWDSQNI*

DNA
ATGGGTGCTCTAGCAGAACTTGTAGCTCTCATTATCGTTATGTGTGCAAGTGTAACAATGTCCCTCGCTCAAAACCCCAT
GGCTTCACCACCAAGTGTTGAGAACCCAAATACAACAGTGGTGATACATAACGCTCTTTCAGGTTATTGGCCAATGGCAT
ACCATTGTGCATCAAAAGACGTTGATTTTGGACTCCGACGTATGCTAGCTGAAAGAGACCAAGAATCTGCAATGTTTGGA
TGCAAAAGATGCGAATGGAAGATACGTGAAGAAGGACCTTGCAAACTGAACAAAAAGACTGGAATGTTTGATCTTTGTCC
TCCTTGGGATTCTCAAAATATTTGA