Details for Arabidopsis Locus AT3G16940

Position : Chr3 ( 5`- 5781775 .. 5786280 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16940

Protein [Map View]
MDGDGLGRLIGSEIHGFHTLQDLDVQTMLEEAKSRWLRPNEIHAILYNPKYFTINVKPVNLPNSGRIILFDRKMLRNFRK
DGHNWKKKKDGRTVKEAHEHLKVGNEERIHVYYAHGEDNTTFVRRCYWLLDKARENIVLVHYRDTQEAATTSGDSISSPI
SVSEQTFPNRVAAEDIDTVVRNHDISLHDINTLDWDELLVPTDLNNQSAPTVDNLSYFTEPLQNAANGTAEHGNATVADG
SLDALLNDGPQSRESFGRWMNSFISESNGSLEDPSFEPMVMPRQDPLAPQAVFHSHSNIPEQVFNITDVSPAWAYSSEKT
KILVTGFLHDSYQHLERSNLYCVCGDFCVPAEYLQAGVYRCIIPPHSPGMVNLYLSADGHKPISQCFRFEHRAVPVLDKT
VPEDNQDSKWEEFEFQVRLSHLLFTSSNKLNVLSSKISPHNLRDAKKLASKTNHLLNSWAYLVKSIQGNKVSFDQAKDHL
FELSLKNRLKEWLMEKVLEGRNTLDYDSKGLGVIHLCASLGYTWSVQLFSLSGLSLNFRDKQGWTALHWAAYYGREKMVA
ALLSAGARPNLVTDSTKDNLGGCMAADLAQQNGYDGLAAYLAEKCLVAQFRDMKIAGNITGDLEACKAEMLNQGTLPEDE
QSLKDALAAYRTAAEAAARIQGAFREKALKAARSSVIQFANKEEEAKSIIAAMKIQNAFRKYDTRRKIEAAYRIQCRFQT
WKIRREYLNMRRQAIRIQAAFRGLQARRQYKKILWSVGVLEKAVLRWRQKRKGFRGLQVAAEEDSPGEAQEDFYKTSQRQ
AEERLERSVVRVQAMFRSKKAQQDYRRMKLTHEEAQLEYGCLEDI*

DNA
ATGGACGGCGACGGTTTAGGCAGACTAATCGGCTCGGAGATTCATGGATTCCATACCTTACAAGATCTTGATGTACAGAC
AATGTTGGAGGAAGCAAAAAGCAGGTGGCTACGGCCAAACGAGATCCATGCAATCCTCTATAACCCGAAATACTTCACTA
TCAATGTCAAGCCAGTGAACTTACCCAATAGTGGCAGAATTATATTATTCGACCGTAAGATGTTGAGGAACTTCAGAAAG
GATGGTCATAACTGGAAAAAGAAAAAGGATGGAAGGACAGTCAAAGAGGCTCATGAACACCTGAAAGTTGGTAACGAGGA
AAGGATTCATGTATACTATGCGCATGGTGAAGATAACACTACCTTTGTTCGAAGATGTTATTGGTTACTGGATAAGGCTC
GAGAGAACATCGTCCTTGTACATTACCGTGATACACAGGAGGCAGCTACAACATCGGGGGACTCAATCTCTAGTCCAATC
TCCGTCTCGGAACAAACATTCCCTAATCGCGTGGCAGCTGAAGATATTGATACAGTTGTTAGAAATCATGATATTAGCCT
TCATGATATCAATACGCTTGATTGGGATGAGCTGCTAGTACCAACCGATCTTAATAACCAATCTGCACCAACCGTAGATA
ATCTTTCATATTTCACAGAACCGCTCCAAAATGCTGCAAATGGCACTGCAGAGCATGGGAATGCGACAGTGGCTGATGGA
TCTCTTGATGCTTTGCTTAACGATGGTCCACAAAGTCGAGAGAGTTTTGGAAGGTGGATGAATTCATTTATCAGCGAATC
TAATGGCTCACTGGAGGATCCTTCCTTTGAACCCATGGTTATGCCTAGGCAGGATCCATTAGCTCCTCAAGCTGTATTTC
ATTCTCACTCTAACATACCTGAGCAAGTGTTTAACATAACCGATGTTTCACCTGCTTGGGCCTATTCTTCCGAGAAAACT
AAGATTCTGGTAACTGGGTTCTTGCATGACAGTTATCAACATCTCGAAAGATCAAACCTTTATTGCGTTTGCGGTGACTT
TTGTGTCCCTGCGGAATATCTCCAGGCTGGAGTCTACCGTTGCATCATACCTCCACACTCGCCTGGTATGGTAAACCTCT
ATCTTAGTGCAGATGGACACAAACCAATCAGCCAATGTTTCAGATTCGAACACCGTGCAGTCCCAGTTCTTGATAAGACC
GTCCCTGAAGACAATCAAGATTCCAAATGGGAAGAGTTTGAGTTCCAAGTTCGACTTTCTCATCTTCTGTTTACGTCTTC
CAACAAACTCAACGTTCTCTCCAGCAAAATCTCACCTCATAACCTGCGAGATGCTAAAAAACTCGCTAGCAAAACAAATC
ATCTCTTAAACAGTTGGGCTTATCTAGTCAAGTCCATCCAGGGGAATAAGGTATCGTTTGATCAAGCGAAAGATCATCTC
TTCGAGCTTTCTCTGAAGAACAGGCTTAAGGAATGGCTTATGGAGAAAGTGCTTGAAGGTCGCAACACATTGGATTATGA
TTCTAAAGGCCTCGGCGTGATCCACCTCTGTGCCAGTCTTGGATACACTTGGTCAGTCCAGCTGTTCTCATTGTCAGGCT
TATCGTTGAATTTCCGTGATAAACAAGGGTGGACTGCTCTTCATTGGGCAGCATACTACGGAAGGGAGAAAATGGTGGCT
GCTCTTCTCTCTGCTGGGGCAAGACCGAACCTGGTGACAGACTCGACGAAGGATAATCTTGGTGGATGCATGGCAGCTGA
TTTGGCACAGCAAAACGGATATGACGGTTTAGCTGCTTATCTTGCTGAGAAATGTTTGGTTGCTCAGTTTAGAGACATGA
AAATTGCTGGAAACATCACTGGCGATCTGGAGGCTTGCAAGGCAGAGATGTTGAACCAAGGCACTCTACCGGAAGATGAG
CAGAGTCTCAAGGATGCTCTTGCAGCATACAGAACAGCTGCAGAAGCAGCGGCTCGGATTCAAGGTGCGTTTAGGGAAAA
AGCGCTAAAGGCAGCACGGTCAAGCGTGATTCAGTTTGCTAACAAAGAAGAAGAGGCCAAGAGCATAATCGCGGCGATGA
AGATTCAGAATGCGTTCCGGAAATATGATACACGTAGGAAGATAGAAGCCGCTTACCGGATTCAATGCAGGTTCCAAACT
TGGAAAATACGAAGAGAGTATCTGAACATGCGGCGCCAAGCAATTAGGATCCAGGCTGCTTTCAGGGGATTACAAGCAAG
GAGGCAGTACAAGAAGATATTGTGGTCGGTAGGAGTATTGGAGAAGGCAGTTTTGAGGTGGAGACAAAAGAGAAAAGGGT
TTAGAGGACTCCAGGTTGCAGCAGAGGAGGATTCTCCTGGTGAGGCACAGGAAGATTTCTACAAGACAAGCCAGAGACAA
GCAGAGGAGAGGCTCGAGAGATCTGTAGTGCGAGTACAAGCCATGTTCAGGTCTAAGAAGGCTCAACAGGATTACAGAAG
GATGAAACTCACTCATGAAGAAGCTCAGTTGGAGTACGGTTGCCTGGAAGATATTTGA