Details for Arabidopsis Locus AT3G16890

Position : Chr3 ( 5`- 5768401 .. 5770380 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16890

Protein [Map View]
MRGFASSASRIATAAAASKSLNASTSVNPKLSKTLNSSGKPTNPLNQRYISQVIERKDWFLILNQEFTTHRIGLNTRFVI
SVLQNQDNPLHSLRFYLWVSNFDPVYAKDQSLKSVLGNALFRKGPLLLSMELLKEIRDSGYRISDELMCVLIGSWGRLGL
AKYCNDVFAQISFLGMKPSTRLYNAVIDALVKSNSLDLAYLKFQQMRSDGCKPDRFTYNILIHGVCKKGVVDEAIRLVKQ
MEQEGNRPNVFTYTILIDGFLIAGRVDEALKQLEMMRVRKLNPNEATIRTFVHGIFRCLPPCKAFEVLVGFMEKDSNLQR
VGYDAVLYCLSNNSMAKETGQFLRKIGERGYIPDSSTFNAAMSCLLKGHDLVETCRIFDGFVSRGVKPGFNGYLVLVQAL
LNAQRFSEGDRYLKQMGVDGLLSSVYSYNAVIDCLCKARRIENAAMFLTEMQDRGISPNLVTFNTFLSGYSVRGDVKKVH
GVLEKLLVHGFKPDVITFSLIINCLCRAKEIKDAFDCFKEMLEWGIEPNEITYNILIRSCCSTGDTDRSVKLFAKMKENG
LSPDLYAYNATIQSFCKMRKVKKAEELLKTMLRIGLKPDNFTYSTLIKALSESGRESEAREMFSSIERHGCVPDSYTKRL
VEELDLRKSGLSRETVSAS*

DNA
ATGAGAGGCTTTGCTTCTTCAGCATCTAGAATAGCGACGGCGGCAGCAGCTTCCAAATCACTAAACGCTTCCACATCCGT
AAACCCTAAGCTCTCAAAAACCCTAAACTCTTCAGGTAAACCCACCAATCCTCTGAACCAGCGTTACATTTCGCAAGTCA
TAGAGAGAAAAGATTGGTTTTTGATACTGAATCAAGAATTCACCACTCATCGAATTGGTCTCAACACTCGATTCGTCATC
AGCGTTTTGCAGAATCAAGACAACCCATTACACTCCCTGCGATTTTACCTCTGGGTCTCCAACTTCGACCCGGTTTACGC
TAAGGATCAGTCTCTGAAGAGTGTTCTAGGGAACGCACTTTTTCGTAAAGGCCCCTTATTGTTGTCTATGGAATTGCTTA
AAGAGATTAGAGATTCAGGGTATCGGATTAGTGATGAATTGATGTGTGTTTTGATCGGAAGCTGGGGAAGATTAGGTTTA
GCTAAGTACTGTAATGATGTTTTTGCTCAGATATCTTTTCTTGGAATGAAACCAAGTACAAGGCTTTATAATGCTGTGAT
TGATGCGTTGGTGAAGTCTAATTCACTTGATTTGGCTTACCTCAAGTTTCAGCAGATGCGTAGTGATGGCTGTAAACCGG
ATCGGTTTACCTATAATATACTTATACATGGTGTTTGCAAGAAGGGTGTGGTTGATGAAGCTATTCGATTGGTTAAACAG
ATGGAACAGGAAGGGAATAGACCCAATGTGTTCACATACACGATTTTGATCGACGGGTTTTTGATAGCAGGGAGGGTTGA
TGAGGCGTTGAAGCAATTGGAGATGATGCGGGTGAGAAAGTTGAATCCTAATGAAGCTACAATCAGAACTTTCGTACACG
GGATTTTCCGTTGCTTGCCGCCGTGTAAAGCGTTTGAGGTTTTGGTTGGGTTTATGGAGAAAGACTCAAACTTGCAAAGA
GTTGGTTACGATGCTGTGTTGTATTGTCTTTCAAACAACTCAATGGCTAAAGAGACTGGTCAATTCTTGAGGAAGATAGG
TGAGAGAGGTTATATTCCGGATAGCTCAACATTCAATGCTGCGATGAGTTGTCTCCTAAAAGGGCATGATCTTGTTGAGA
CTTGTAGGATATTTGACGGTTTTGTCAGCCGTGGAGTTAAGCCAGGATTCAATGGTTATCTTGTGTTAGTTCAAGCTCTG
TTGAATGCTCAGAGGTTCTCTGAAGGTGACCGGTATCTGAAACAAATGGGTGTTGACGGGCTTCTATCAAGTGTATATAG
TTATAATGCGGTAATTGACTGTCTCTGCAAGGCTCGACGCATAGAGAATGCAGCTATGTTCTTAACAGAGATGCAGGATA
GAGGTATTTCTCCGAATCTCGTAACTTTCAATACCTTTCTGAGCGGTTATAGCGTGAGGGGTGATGTAAAGAAGGTTCAC
GGCGTGCTAGAGAAGCTTCTTGTACATGGTTTCAAACCAGACGTGATCACTTTCAGTTTGATCATAAACTGTCTTTGCAG
AGCAAAAGAAATTAAAGATGCATTTGACTGTTTCAAGGAGATGTTGGAATGGGGTATTGAGCCAAACGAGATCACATACA
ATATCTTGATTCGCTCCTGTTGTTCCACCGGAGATACCGATAGATCAGTGAAGCTGTTTGCGAAGATGAAGGAAAACGGG
TTAAGTCCAGACCTTTATGCGTACAATGCGACTATTCAGAGTTTTTGCAAGATGAGAAAGGTTAAGAAGGCTGAGGAATT
GCTTAAAACAATGCTGAGAATTGGTTTGAAACCAGATAACTTTACATATAGCACTCTCATCAAAGCTCTAAGTGAATCTG
GAAGAGAGAGTGAAGCAAGAGAGATGTTCAGTTCAATCGAAAGACATGGATGTGTTCCAGATTCATATACTAAGCGTCTT
GTTGAAGAACTTGACCTAAGAAAAAGTGGACTCTCGAGAGAAACCGTGTCAGCCTCATAG