Details for Arabidopsis Locus AT3G16870

Position : Chr3 ( 5`- 5763586 .. 5764654 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16870

Protein [Map View]
MSEGSEDTKTKLDSAGELSDVDNENCSSSGSGGGSSSGDTKRTCVDCGTIRTPLWRGGPAGPKSLCNACGIKSRKKRQAA
LGMRSEEKKKNRKSNCNNDLNLDHRNAKKYKINIVDDGKIDIDDDPKICNNKRSSSSSSNKGVSKFLDLGFKVPVMKRSA
VEKKRLWRKLGEEERAAVLLMALSCSSVYA*

DNA
ATGTCTGAGGGATCAGAAGATACGAAAACAAAACTCGACTCTGCCGGAGAGTTATCAGATGTTGATAACGAGAACTGCAG
TAGCAGCGGAAGTGGCGGTGGTAGTAGTTCTGGTGATACCAAAAGGACTTGCGTTGATTGCGGAACTATCCGAACTCCTC
TTTGGCGTGGTGGTCCTGCCGGACCAAAGTCATTGTGCAATGCTTGTGGGATCAAGAGTAGGAAGAAGAGACAAGCAGCA
CTTGGTATGAGATCAGAGGAGAAGAAGAAGAACAGAAAAAGCAATTGCAATAATGATCTAAACCTCGACCATCGAAACGC
CAAGAAATACAAAATCAACATAGTTGATGATGGCAAGATCGACATCGATGATGATCCGAAAATTTGCAATAACAAGCGTA
GTAGTAGTAGTAGCAGTAACAAAGGAGTGAGTAAGTTTTTGGATTTAGGGTTTAAAGTACCGGTGATGAAGAGATCAGCG
GTTGAGAAGAAGAGGTTATGGAGAAAACTCGGTGAGGAAGAAAGAGCTGCTGTGCTTCTCATGGCTCTCTCTTGTAGCTC
TGTTTACGCCTAA