Details for Arabidopsis Locus AT3G16840

Position : Chr3 ( 5`- 5737886 .. 5743144 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16840

Protein [Map View]
MVTGDKESSLMKKRNKRSHKRKREEDFERIDSLPWSSSIPIGEDDEGESFSTLFSGSGQLDGGFLSLEEIDEADYHLTLP
TIESEITERKQSPEDDDDTNETVDEMIEGEEAEEDGEGRDDEDDEDDEETRKKKEKKAKRNKEKKKEKKKKKQKKINEAA
KNQDASAVSCDGDDTVEEQVEEEEIPPEFSAWSSMRLHPLLMKSIYRLDFKEPTKIQKACFNVAAYQGKDVIGAAETGSG
KTLAFGLPILQRLLDEREKVGKLYALKGEEAQKYAADGYLRALIITPTRELALQVTEHLENAAKNLSVKVVPIVGGMFSE
KQERRLKEKPEIVVATPGRLWELMSAGEKHLVELHSLSFFVLDEADRMVERGHFRELQSILDLLPVTDKPNEGKTQTVKS
NDTVLNVPKKKRQTFVFSATIALSSDFRKKLKRGSSKSKQSSSGEVNSIEVLSERAGMRDNVAIIDLTTTSILAPKIEES
FIKCEEKEKDAYLYYILSVHGQGRTIVFCTSVTDLRHISGLLKILGLDVCTLFSEMKQRARLKSIDRFRASENGILIATD
LVARGIDIKNVRTIIHYKLPHSAEVYVHRCGRTARAFADGCSIALIEPNETSKFYTLCKSFSMESVKIFPLDNSYMPAVR
KRLYLARQIYEIERKGSRENADRTWLKKHAESMELELDDEESEEERVDNVRQRKATSARLNKLKEELSTLLSHPMQPKKF
SGRYFAGVGVSTLMQNQFVELKKQKQAQMQIGGDIKRRKLVVINQNCIEPLQALRAGGNEMLKMKGQSAEKRRDIASLKK
KRKEEKIGRRDQRRNQKKQRKLMASS*

DNA
ATGGTTACAGGCGATAAAGAATCTTCCTTGATGAAGAAGAGGAACAAGAGAAGCCATAAGAGAAAGCGAGAGGAGGATTT
CGAACGTATAGATTCACTTCCTTGGAGCTCTTCTATACCCATTGGAGAAGACGACGAAGGCGAATCCTTCTCCACTCTAT
TTTCAGGCTCAGGCCAGCTCGACGGAGGTTTTCTATCACTTGAGGAGATTGATGAAGCTGATTACCATCTAACTCTCCCT
ACCATTGAAAGTGAAATAACAGAGAGAAAACAATCTCCAGAAGATGATGATGATACCAACGAGACAGTGGATGAGATGAT
TGAAGGAGAAGAAGCTGAAGAAGATGGAGAAGGAAGGGATGATGAGGATGACGAAGATGACGAGGAGACTCGTAAGAAAA
AAGAGAAGAAAGCTAAGAGGAATAAGGAGAAGAAAAAAGAGAAGAAGAAGAAGAAGCAGAAGAAGATTAATGAGGCCGCA
AAGAATCAGGACGCTTCTGCTGTTAGCTGTGATGGAGATGACACAGTAGAGGAGCAAGTTGAGGAAGAAGAGATTCCTCC
AGAATTTAGTGCATGGAGTTCGATGAGACTCCATCCACTACTCATGAAGTCCATATACCGCCTCGATTTCAAGGAGCCAA
CAAAAATCCAGAAGGCTTGTTTTAACGTTGCAGCATATCAGGGAAAGGATGTTATTGGTGCTGCAGAGACAGGATCTGGA
AAGACACTTGCTTTTGGGTTGCCCATACTGCAACGCCTCTTAGACGAGCGGGAAAAGGTTGGTAAATTGTATGCATTAAA
GGGAGAAGAAGCACAGAAATATGCTGCAGATGGCTATTTACGAGCTCTAATCATCACTCCAACTAGGGAACTTGCTCTTC
AGGTGACGGAGCATCTTGAGAATGCTGCCAAGAATCTTAGCGTCAAGGTCGTTCCTATTGTTGGTGGGATGTTTTCAGAG
AAGCAGGAAAGACGTTTAAAAGAGAAACCTGAAATAGTTGTTGCAACTCCAGGAAGGTTATGGGAACTTATGTCCGCTGG
AGAAAAGCATCTTGTAGAGCTGCATTCCTTGTCGTTCTTTGTGTTGGACGAGGCTGATCGCATGGTTGAAAGAGGTCATT
TCAGGGAGCTGCAGTCTATACTCGACTTGCTTCCAGTGACAGATAAACCAAATGAAGGGAAAACGCAAACTGTGAAGAGT
AATGACACAGTTTTAAACGTCCCGAAGAAGAAAAGACAAACTTTTGTTTTCTCAGCCACCATAGCGCTGTCTTCGGATTT
CCGTAAAAAGCTAAAGCGTGGCTCCTCAAAGTCAAAGCAATCATCATCTGGTGAAGTGAATTCTATTGAGGTTTTATCTG
AACGAGCTGGAATGAGAGATAATGTTGCCATCATTGATCTGACAACTACATCTATTTTGGCACCAAAGATTGAAGAATCT
TTTATTAAGTGCGAAGAGAAGGAAAAAGACGCATACTTGTATTATATTTTGAGCGTCCATGGACAAGGGCGGACAATTGT
TTTCTGCACATCAGTGACTGATTTGCGGCATATCTCTGGGCTTTTAAAGATTCTTGGACTTGATGTTTGCACACTCTTCT
CAGAAATGAAGCAGCGAGCTCGGTTGAAGTCAATCGACCGTTTCCGTGCGAGCGAAAATGGAATACTCATAGCAACAGAT
CTTGTAGCAAGGGGTATTGATATTAAGAATGTCCGAACTATTATTCACTACAAACTTCCACATTCGGCAGAAGTGTATGT
ACATAGATGTGGGAGGACTGCTAGAGCATTCGCAGATGGATGCAGTATAGCTTTGATTGAGCCAAATGAGACGTCCAAGT
TTTACACGTTATGCAAGTCATTCTCTATGGAAAGCGTAAAGATATTCCCTTTGGATAACTCTTATATGCCAGCTGTGAGG
AAGCGATTATATCTAGCACGTCAAATATATGAGATTGAGCGGAAAGGCTCGCGGGAGAATGCAGACAGGACCTGGCTTAA
AAAACATGCTGAATCAATGGAACTCGAATTGGACGATGAAGAAAGTGAAGAGGAAAGAGTGGACAATGTCAGGCAGAGAA
AAGCGACCTCAGCACGACTTAATAAGCTGAAGGAGGAACTTAGCACGCTCTTATCACATCCGATGCAGCCCAAGAAATTT
TCAGGCCGTTACTTTGCTGGGGTTGGTGTGTCGACTCTTATGCAGAATCAGTTTGTAGAGTTAAAGAAGCAAAAACAAGC
ACAAATGCAAATTGGTGGAGATATAAAGAGAAGAAAACTTGTTGTCATTAACCAGAACTGCATCGAACCTCTTCAAGCCC
TTCGTGCTGGTGGTAACGAGATGCTGAAAATGAAAGGTCAGAGTGCAGAGAAGAGGCGCGATATAGCGAGCTTGAAAAAG
AAAAGAAAGGAAGAGAAGATAGGTCGGCGTGATCAACGAAGGAACCAGAAGAAACAGAGAAAACTAATGGCTTCTTCTTA
A