Details for Arabidopsis Locus AT3G16830

Position : Chr3 ( 5`- 5731534 .. 5737772 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16830

Protein [Map View]
MSSLSRELVFLILQFLDEEKFKESVHKLEQESGFFFNIKYFEEKALAGEWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQK
YLEALDRNDRAKAVEILAKDLKVFATFNEELYKEITQLLTLENFRENEQLSKYGDTKSARSIMYTELKKLIEANPLFREK
LAFPSFKASRLRTLINQSLNWQHQLCKNPRPNPDIKTLFLDHSCSPSNGARALTPVNLPVAAVARPSNFVPLGVHGGPFQ
SNPAPAPNANALAGWMANPNPSSSVPSGVVAASPFPMQPSQVNELKHPRAPSNSLGLMDYQSADHEQLMKRLRSAQTSNE
VTYPAHSHPPASLDDLPRNVVSTIRQGSVVISMDFHPSHHTLLAVGCSSGEVTLWEVGSREKVVTEPFKIWNMAACSVIF
QGSIVKEPSISVTRVAWSPDGNLLGVSFTKHLIHVYAYQGSDLRQHLEIDAHVGCVNDLAFAHPNKQMCVVTCGDDKLIK
VWDLSGKKLFTFEGHEAPVYSICPHQKENIQFIFSTALDGKIKAWLYDNVGSRVDYDAPGQWCTTMLYSADGSRLFSCGT
SKEGDSFLVEWNESEGALKRTYLGFRKKSAGVVQFDTTRNRFLAVGEDNQIKFWNMDNTNLLTVVEAEGGLPNLPRLRFN
KDGNLLAVTTADNGFKILANTDGLRTLRAFEARSFEASKASIDMKVSTSAMASSISPAIGKIEHMDAGSPARPTPIPNGI
EAMSRTMEKPRNLDSVDKSKPLELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGSNGVQRLWKWIRNEQN
PTGKATASVTPQHWQPNSGLLMANDVPENPEGSVPCIALSKNDSYVMSACGGKVSLFNMMTFKVMTTFMPPPPASTFLAF
HPQDNNIIAIGMEDSSIHIYNVRVDEVKTKLKGHQKHITGLAFSTALNILVSSGADAQLFFWTADSWEKKKSSAIQLPPG
KAPVGDTRVQFHNDQIQLLVSHETQLAIYDASKMECIHKWVPQEALSSPITSASYSCNSQLVYASFADGNIAVFDAESLR
LRCRIAPSAYMPQPTPNSAPIFPQVITAHPQEPNQLAVGLSDGSVKVIEPSELSRRWGVGVAAGSDKAGTENGRPSSSSA
ANNSSSDQIQR*

DNA
ATGTCGTCTTTGAGCAGAGAGTTAGTTTTCTTAATTCTCCAGTTCTTAGATGAGGAGAAGTTCAAGGAATCTGTTCACAA
GCTAGAGCAAGAATCTGGCTTCTTCTTTAACATTAAGTACTTTGAAGAGAAAGCTCTTGCTGGAGAGTGGGATGAAGTGG
AGAAGTATCTTTCTGGTTTCACTAAAGTCGATGATAATCGTTACTCTATGAAAATCTTCTTTGAGATTAGGAAGCAAAAG
TATCTCGAAGCTCTAGATCGAAATGACAGAGCAAAAGCTGTTGAGATATTAGCCAAAGACTTGAAAGTTTTCGCTACATT
TAACGAGGAGCTTTACAAGGAGATTACTCAGCTGCTTACTCTGGAGAATTTTAGGGAAAATGAGCAACTGTCGAAATATG
GTGATACTAAATCTGCAAGGTCTATAATGTATACTGAGTTGAAGAAATTGATTGAGGCGAATCCTCTGTTTCGAGAGAAG
CTAGCCTTCCCCAGTTTCAAAGCTTCTCGCCTGCGAACTTTGATCAATCAAAGCTTAAACTGGCAGCATCAGCTATGTAA
AAATCCAAGGCCTAATCCTGACATCAAGACATTGTTCTTGGATCACTCTTGCTCACCATCAAACGGTGCTCGTGCACTCA
CTCCTGTCAATCTTCCAGTTGCTGCTGTTGCAAGACCTTCAAACTTTGTTCCTCTTGGAGTGCATGGTGGACCCTTTCAA
TCTAATCCTGCTCCGGCTCCTAATGCCAATGCTTTAGCTGGATGGATGGCAAACCCAAATCCTTCTTCATCAGTTCCATC
TGGTGTTGTCGCTGCTTCCCCATTTCCTATGCAGCCAAGTCAAGTTAATGAGCTGAAACACCCTCGGGCACCGTCTAACT
CTCTAGGATTAATGGATTATCAAAGTGCTGATCACGAGCAACTCATGAAACGCTTACGGTCTGCACAAACATCCAACGAG
GTCACATATCCTGCTCATTCTCATCCCCCTGCGTCACTTGATGACCTCCCTAGAAATGTAGTGAGTACAATTCGCCAAGG
GTCGGTGGTGATAAGCATGGATTTTCACCCTTCTCATCACACTTTGCTCGCTGTTGGTTGTTCAAGCGGCGAAGTCACCT
TGTGGGAAGTTGGATCCAGAGAAAAGGTTGTCACAGAACCTTTCAAGATATGGAATATGGCGGCTTGTTCTGTGATCTTC
CAGGGTTCTATAGTCAAAGAGCCATCGATATCCGTCACTCGTGTAGCATGGAGCCCAGATGGAAACTTGCTTGGGGTTTC
TTTTACTAAACATCTGATCCATGTATATGCTTACCAAGGCTCAGACCTACGTCAACACCTCGAGATTGATGCTCATGTAG
GCTGTGTGAATGACTTGGCGTTCGCCCACCCAAATAAGCAAATGTGTGTTGTGACTTGTGGGGATGACAAATTGATTAAG
GTGTGGGATTTGAGTGGGAAGAAGCTCTTCACCTTTGAAGGGCACGAGGCACCAGTTTATTCCATTTGCCCTCACCAGAA
GGAAAATATTCAGTTTATATTCTCAACCGCTCTTGATGGAAAGATCAAGGCGTGGCTCTATGATAATGTTGGTTCTCGGG
TTGATTATGACGCACCGGGACAGTGGTGTACAACAATGCTCTACAGTGCTGATGGAAGCAGACTATTTTCTTGTGGGACG
AGTAAAGAAGGAGACTCTTTCCTCGTCGAGTGGAATGAGAGTGAAGGTGCCCTAAAGAGGACATATTTAGGCTTTAGGAA
GAAATCAGCTGGAGTTGTTCAGTTTGATACAACCCGTAACCGTTTCTTGGCTGTTGGTGAAGACAATCAAATAAAATTCT
GGAACATGGACAATACAAATCTTTTGACAGTTGTTGAGGCTGAAGGTGGACTTCCGAATCTACCCCGATTGAGATTCAAC
AAGGATGGGAATCTTCTTGCAGTTACTACAGCAGATAATGGATTCAAGATCCTTGCAAATACTGATGGTCTCAGAACCTT
AAGAGCATTTGAAGCGCGGTCTTTTGAAGCATCTAAAGCATCCATTGATATGAAGGTATCCACCTCCGCAATGGCTTCAA
GCATCAGCCCCGCTATTGGTAAAATTGAACACATGGACGCAGGCTCTCCTGCAAGGCCAACCCCAATTCCTAATGGAATT
GAGGCAATGTCAAGAACTATGGAAAAGCCAAGAAACTTGGACTCTGTTGATAAGTCTAAACCTTTAGAGCTCACAGAAAT
TGTTGATCCGACTCAGTGCCGACAAGTGACAATGCCAGATAGCAAGGACTCTGTTAGCAAGGTTGCTCGGCTTCTTTACA
CAAATTCTGGCGTTGGTGTTTTGGCTCTTGGATCAAATGGTGTTCAAAGACTATGGAAGTGGATCCGCAATGAGCAAAAT
CCAACTGGGAAGGCAACTGCTAGTGTAACTCCACAGCATTGGCAGCCAAACAGCGGTCTCCTAATGGCAAATGATGTTCC
CGAGAATCCTGAAGGGAGTGTTCCGTGTATAGCACTTTCCAAGAATGACTCATACGTAATGTCAGCTTGTGGTGGAAAGG
TTTCGTTATTCAATATGATGACTTTCAAAGTAATGACAACTTTCATGCCACCGCCACCAGCTTCAACTTTCTTGGCATTT
CATCCTCAAGATAATAATATTATTGCAATCGGGATGGAGGACTCGAGTATACATATTTACAACGTCAGGGTAGATGAGGT
GAAAACAAAGTTGAAAGGTCACCAGAAGCACATAACTGGTCTAGCATTCTCTACCGCGCTCAATATTCTTGTCTCTTCTG
GTGCCGATGCTCAGCTCTTCTTCTGGACCGCTGACTCGTGGGAGAAAAAGAAATCTTCAGCGATACAGCTACCACCTGGC
AAAGCACCAGTAGGCGACACACGAGTCCAATTCCACAACGACCAAATCCAGTTATTGGTTTCACATGAGACACAGCTCGC
CATTTACGATGCTTCGAAGATGGAATGCATTCATAAGTGGGTGCCCCAAGAAGCTCTCTCTTCGCCCATAACCTCTGCAT
CTTACTCATGCAACAGCCAACTGGTTTACGCGTCATTCGCTGATGGAAACATTGCAGTCTTTGATGCTGAATCCTTGAGA
CTCAGATGCCGCATTGCCCCATCAGCCTACATGCCTCAACCTACACCAAACAGTGCACCGATTTTCCCACAGGTGATCAC
AGCTCATCCACAAGAACCGAATCAATTAGCGGTTGGACTGTCTGATGGTTCGGTTAAAGTGATTGAGCCATCAGAACTTT
CTAGAAGATGGGGTGTTGGCGTCGCAGCTGGTTCAGATAAAGCAGGGACTGAAAATGGACGGCCGTCTAGTTCATCAGCG
GCTAACAACTCAAGTTCGGATCAGATTCAAAGGTAA