Details for Arabidopsis Locus AT3G16810

Position : Chr3 ( 5`- 5723249 .. 5727620 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16810

Protein [Map View]
MSSKGLKPQKSTKRKDTDSSAKFDSLKSKKPKLVSGEQQQHVKPKFGKPKSAGDKEQSTNLSKKERRVQAKELTEARKKK
RKPHYNLEQELVSLWEKMRRRNIGKEDRSKLISEAIRKMKGKVPEIAVSHVSSRVLQTCVKFCSQAEKDVLFTELQPQFL
NLASNKYAVHFIQKMLDGASKQQLAACISSLRGHVAPLLRHVFGSLVVEHAYHLGSAAQKQELLAELYSTELQLFKGLTT
SNEKTVVDIIAKLGLQKGAVNRHMTAIIQPILEKGIVDHTITHKLLIEYLTIADKTSAADVLQLLTGSLLLRMVHTRDGS
RLAMLSIKHGSAKERKKIIKAMKEHVKKMAFDQFGSMVLACIFSIVDDTKLVTKIIVRELEATLKDLVMDKNGRRPLLQL
LHPNSSRYLSHDDLAALDLSVPSLCSMDKSETSSKTKDTDGNEIGEETKDEQEDTVAEHSDHEENVTAMGGKKDPLVRRQ
ELLVNSGLAERLIDVCVENAEEFLQSKFGNEVMYEVAIGGSDGILCPSLSEKLCELYEAISSVAAEPKPQESEKDSEHIL
ENFHSSRTIRRLVLNRPGFASILFKKALSGKCRSWAQGHCSKILSAFVETEDVQVREMAKTELQVLVNEGTLKISATKKP
E*

DNA
ATGTCTTCCAAAGGTCTGAAACCTCAGAAATCAACCAAGAGGAAGGACACCGATAGCTCTGCCAAATTCGATTCTCTAAA
ATCAAAGAAGCCAAAGCTAGTGTCTGGAGAACAACAACAACATGTGAAACCTAAATTTGGTAAACCCAAATCTGCAGGTG
ATAAGGAGCAGAGTACTAATCTATCGAAGAAGGAGCGTCGTGTACAGGCTAAGGAGCTAACAGAAGCTAGGAAGAAGAAG
AGAAAGCCTCATTACAATCTTGAGCAAGAGCTTGTATCTCTATGGGAGAAGATGAGACGCCGTAATATCGGCAAGGAGGA
TCGATCAAAGCTGATTTCTGAAGCTATAAGGAAGATGAAGGGGAAGGTTCCAGAGATTGCAGTCTCACATGTTTCATCTC
GTGTACTTCAGACTTGTGTGAAGTTTTGCTCACAAGCTGAGAAAGATGTTCTCTTCACGGAACTCCAGCCACAGTTTCTT
AACCTTGCTTCTAACAAATATGCTGTTCACTTTATACAGAAGATGTTGGATGGAGCATCTAAGCAGCAGCTGGCAGCTTG
TATATCCAGCCTCAGGGGACATGTTGCTCCTCTTCTCCGTCATGTGTTCGGATCTCTTGTTGTGGAGCATGCATACCATC
TGGGAAGTGCAGCACAAAAACAAGAACTCCTTGCAGAATTGTATTCTACTGAGCTTCAGTTATTCAAGGGCTTGACCACA
TCTAACGAAAAAACGGTGGTGGACATCATTGCTAAGCTGGGACTGCAAAAAGGCGCTGTTAACCGACACATGACTGCCAT
TATCCAACCGATACTTGAGAAGGGAATTGTCGACCACACTATCACACACAAATTGCTGATTGAATACCTGACAATAGCTG
ATAAGACTTCTGCTGCAGATGTGCTTCAGCTACTGACAGGCTCCCTTCTTTTGCGTATGGTTCATACCCGTGATGGTTCT
AGGCTTGCCATGCTTTCTATCAAACATGGAAGCGCTAAGGAGAGAAAGAAGATTATCAAAGCAATGAAAGAGCATGTTAA
AAAGATGGCTTTTGATCAGTTTGGAAGTATGGTGCTTGCATGTATTTTTTCAATAGTTGATGACACAAAGCTCGTGACCA
AGATAATTGTTCGTGAGCTTGAGGCCACCCTAAAGGATCTTGTTATGGACAAGAATGGTAGGAGACCGCTATTGCAGCTA
CTGCATCCAAATTCCTCACGTTATTTAAGCCATGATGATTTGGCCGCTCTTGATCTTTCTGTTCCATCACTCTGCTCAAT
GGATAAGTCAGAGACATCCTCTAAAACAAAGGACACAGATGGTAACGAAATTGGTGAGGAGACGAAGGATGAACAAGAAG
ATACAGTAGCTGAACATTCTGATCATGAAGAAAACGTCACAGCTATGGGTGGTAAAAAAGACCCCCTTGTGAGAAGACAG
GAGTTGCTTGTCAACAGTGGCCTTGCTGAGAGGCTTATTGATGTGTGTGTGGAGAACGCCGAGGAATTCCTCCAGTCAAA
ATTTGGCAATGAGGTCATGTATGAGGTTGCAATCGGAGGCTCTGATGGTATTCTCTGCCCATCTCTGAGCGAGAAGCTGT
GTGAGCTGTACGAAGCTATTAGCTCTGTAGCAGCAGAACCGAAACCCCAAGAATCTGAGAAGGATTCAGAACACATCCTG
GAAAACTTTCACTCAAGTCGGACCATAAGAAGGCTTGTCTTGAATCGCCCTGGTTTCGCGTCCATTCTCTTTAAGAAGGC
CTTGTCTGGAAAATGTCGGTCGTGGGCACAAGGACACTGTTCAAAGATACTATCTGCTTTCGTAGAGACTGAAGATGTTC
AAGTTCGTGAGATGGCTAAAACAGAGCTTCAGGTGTTGGTGAATGAAGGTACTCTGAAGATCTCAGCAACCAAGAAACCT
GAATGA