Details for Arabidopsis Locus AT3G16800

Position : Chr3 ( 5`- 5721020 .. 5723185 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16800

Protein [Map View]
MVLLPAFLDGLARTVSTKKGKKLSEDEDGGREIAKSMIKDSKKNSTLLGTSGFVSSESSKRFTSICSNRGEKGINQDRAI
VWEGFGCQEDITFCGMFDGHGPWGHVIAKRVKKSFPSSLLCQWQQTLASLSSSPECSSPFDLWKQACLKTFSIIDLDLKI
SPSIDSYCSGCTALTAVLQGDHLVIANAGDSRAVIATTSDDGNGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDEPG
VYRVGMPNGGSLGLAVSRAFGDYCLKDFGLVSEPEVTYRKITDKDQFLILATDGMWDVMTNNEAVEIVRGVKERRKSAKR
LVERAVTLWRRKRRSIAMDDISVLCLFFRPS*

DNA
ATGGTGCTTTTACCAGCGTTTTTGGACGGATTAGCGAGAACTGTATCGACGAAGAAAGGTAAAAAACTATCGGAAGATGA
AGATGGAGGGAGAGAGATCGCAAAATCGATGATTAAAGATTCGAAGAAGAACTCGACGTTGCTCGGTACTTCAGGCTTTG
TTAGCTCCGAAAGTTCTAAGAGGTTTACCTCTATTTGTTCTAATAGAGGTGAGAAAGGAATCAACCAAGATCGTGCAATT
GTTTGGGAGGGATTTGGGTGCCAAGAAGACATAACATTTTGTGGGATGTTTGATGGACATGGACCATGGGGACATGTGAT
AGCCAAAAGAGTAAAAAAATCATTTCCATCTTCTCTGCTTTGCCAATGGCAACAAACTCTTGCCTCCTTATCATCCTCGC
CGGAATGTTCCTCTCCGTTTGATCTTTGGAAGCAAGCTTGCCTGAAAACATTCTCCATCATCGATCTTGATCTCAAGATC
AGTCCTTCCATTGATTCTTACTGTAGCGGCTGCACCGCTCTCACCGCTGTTTTGCAGGGTGATCATCTCGTTATAGCAAA
TGCGGGTGACTCACGAGCAGTAATAGCAACAACTTCTGATGATGGAAACGGTTTAGTCCCGGTTCAGCTCTCGGTAGACT
TTAAACCAAACATTCCCGAGGAAGCAGAACGGATAAAACAATCGGATGGACGATTGTTCTGCCTAGACGATGAACCGGGA
GTGTACCGGGTGGGTATGCCTAATGGAGGATCACTCGGTTTAGCTGTTTCAAGAGCGTTTGGAGATTACTGCCTTAAAGA
CTTCGGTTTAGTCTCTGAACCGGAAGTAACATACCGAAAGATAACCGACAAGGACCAGTTTCTAATCTTGGCCACCGATG
GGATGTGGGATGTGATGACGAATAATGAGGCAGTGGAGATAGTAAGAGGAGTTAAAGAGAGAAGAAAGAGCGCAAAGAGA
TTGGTAGAGAGAGCTGTGACGCTTTGGCGTAGGAAGAGAAGAAGCATCGCCATGGATGATATTTCTGTTCTCTGTCTCTT
CTTTCGTCCTTCTTAG