Details for Arabidopsis Locus AT3G16780

Position : Chr3 ( 5`- 5708925 .. 5710579 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16780

Protein [Map View]
MVSLKIQKRLAASVMKCGKGKVWLDPNESGDISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARALNEAKRKGRHSGYGK
RKGTREARLPTKILWMRRMRVLRRFLSKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKMKAEKAREKTLADQFE
AKRIKNKASRERKFARREERLAQGPGGGETTTPAGAPQQPEVTKKKSKK*

DNA
ATGGTGTCGCTGAAGATCCAGAAGCGGCTCGCCGCATCCGTAATGAAATGCGGGAAAGGAAAAGTTTGGCTCGACCCCAA
TGAATCGGGCGATATCTCTATGGCCAATTCCAGGCAGAACATTAGGAAGCTTGTGAAGGATGGTTTCATTATCAGGAAGC
CTACTAAGATCCACTCACGTTCTCGGGCTAGGGCTTTGAACGAGGCCAAGCGAAAGGGTCGTCACTCTGGATACGGTAAG
AGAAAGGGTACAAGAGAGGCAAGGCTACCAACCAAGATTCTTTGGATGAGGAGAATGAGGGTGTTGAGGCGTTTCTTGAG
CAAGTACCGTGAGTCAAAGAAGATTGATAGGCACATGTACCATGACATGTACATGAAAGTGAAGGGTAATGTTTTCAAGA
ACAAGCGTGTGCTTATGGAGAGCATCCACAAGATGAAGGCTGAGAAGGCTAGAGAGAAGACTCTCGCTGACCAGTTTGAG
GCCAAGCGTATTAAGAACAAGGCTAGCAGGGAGAGAAAGTTTGCCAGAAGAGAGGAGAGATTAGCTCAGGGACCTGGAGG
TGGAGAGACAACGACTCCTGCTGGCGCACCTCAACAACCAGAGGTAACCAAGAAGAAGTCGAAGAAGTGA