Details for Arabidopsis Locus AT3G16770

Position : Chr3 ( 5`- 5705662 .. 5707023 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16770

Protein [Map View]
MCGGAIISDYAPLVTKAKGRKLTAEELWSELDASAADDFWGFYSTSKLHPTNQVNVKEEAVKKEQATEPGKRRKRKNVYR
GIRKRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAAMAYDVAAKQIRGDKAKLNFPDLHHPPPPNYTPPPSSPRSTDQPPA
KKVCVVSQSESELSQPSFPVECIGFGNGDEFQNLSYGFEPDYDLKQQISSLESFLELDGNTAEQPSQLDESVSEVDMWML
DDVIASYE*

DNA
ATGTGTGGCGGTGCTATTATTTCCGATTATGCCCCTCTCGTCACCAAGGCCAAGGGCCGTAAACTCACGGCTGAGGAACT
CTGGTCAGAGCTCGATGCTTCCGCCGCCGACGACTTCTGGGGTTTCTATTCCACCTCCAAACTCCATCCCACCAACCAAG
TTAACGTGAAAGAGGAGGCAGTGAAGAAGGAGCAGGCAACAGAGCCGGGGAAACGGAGGAAGAGGAAGAATGTTTATAGA
GGGATACGTAAGCGTCCATGGGGAAAATGGGCGGCTGAGATTCGAGATCCACGAAAAGGTGTTAGAGTTTGGCTTGGTAC
GTTCAACACGGCGGAGGAAGCTGCCATGGCTTATGATGTTGCGGCCAAGCAGATCCGTGGTGATAAAGCCAAGCTCAACT
TCCCAGATCTGCACCATCCTCCTCCTCCTAATTATACTCCTCCGCCGTCATCGCCACGATCAACCGATCAGCCTCCGGCG
AAGAAGGTCTGCGTTGTCTCTCAGAGTGAGAGCGAGTTAAGTCAGCCGAGTTTCCCGGTGGAGTGTATAGGATTTGGAAA
TGGGGACGAGTTTCAGAACCTGAGTTACGGATTTGAGCCGGATTATGATCTGAAACAGCAGATATCGAGCTTGGAATCGT
TCCTTGAGCTGGACGGTAACACGGCGGAGCAACCGAGTCAGCTTGATGAGTCCGTTTCCGAGGTGGATATGTGGATGCTT
GATGATGTCATTGCGTCGTATGAGTAA