Details for Arabidopsis Locus AT3G16680

Position : Chr3 ( 5`- 5683336 .. 5684245 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16680

Protein [Map View]
MKKYIDQLKSANVFRAILVVQDIKAFSRQALVFLGAVYPIFHIEVFQEKELIVNVKEHVFVPEHQALTTEEKQKFLERKR
TSFQGFT*

DNA
ATGAAGAAATACATAGACCAGTTAAAATCGGCAAACGTTTTCAGAGCAATTTTAGTGGTGCAAGATATAAAGGCATTTTC
TCGCCAGGCTCTGGTTTTTTTAGGTGCGGTCTATCCAATATTTCATATTGAAGTTTTCCAGGAGAAGGAATTGATAGTGA
ACGTTAAGGAACATGTTTTTGTTCCTGAGCATCAAGCTCTTACTACTGAAGAGAAGCAAAAGTTTCTAGAGAGAAAGAGA
ACCAGCTTCCAAGGATTCACGTGA