Details for Arabidopsis Locus AT3G16660

Position : Chr3 ( 5`- 5676829 .. 5677921 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16660

Protein [Map View]
MAMLKNKHMTVSLILVCLVVVSPMAEAQLGLGGSGGLGGLIGGLVGGLGGLVGGLVGGILNLVNINGVVFCSLNGAPSGT
STPAFANAGVELQCGRQNRVVSTATTNAAGLFSLPTDSIQMLLSTLLSDCRVVVTTPLSTCNANLPSVGNLVSRLAMIGN
SLTGLLNIISIIPAGFGLLN*

DNA
ATGGCAATGTTAAAGAACAAACACATGACCGTCTCATTGATCTTGGTGTGTCTCGTTGTGGTGTCTCCAATGGCTGAGGC
TCAGCTTGGTCTTGGTGGTAGTGGTGGTCTTGGTGGTCTTATTGGGGGTCTTGTTGGGGGTCTCGGTGGTCTGGTTGGTG
GTCTTGTAGGGGGTATTCTCAATCTCGTCAATATCAATGGGGTTGTCTTTTGCTCTCTCAATGGTGCTCCCAGTGGCACT
TCCACTCCTGCTTTCGCTAATGCAGGAGTTGAGCTCCAGTGCGGAAGGCAAAACAGGGTCGTTTCAACAGCGACCACGAA
TGCTGCCGGATTATTCTCGCTTCCTACGGACTCAATTCAGATGTTACTTTCCACACTTCTCTCTGATTGTCGGGTCGTCG
TCACGACCCCTCTCTCCACCTGCAACGCCAACCTCCCTTCCGTTGGCAACCTCGTCTCACGGTTAGCCATGATCGGCAAT
AGTCTCACCGGCCTCCTCAACATCATCAGTATCATCCCTGCCGGCTTTGGTCTTCTTAACTGA