Details for Arabidopsis Locus AT3G16640

Position : Chr3 ( 5`- 5669373 .. 5670842 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16640

Protein [Map View]
MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVTVGAVDVNIGANPSAEEGGEDEGVDDSTQKVVDIVDTFRLQEQP
TYDKKGFIAYIKKYIKLLTPKLSEEDQAVFKKGIEGATKFLLPRLSDFQFFVGEGMHDDSTLVFAYYKEGSTNPTFLYFA
HGLKEVKC*

DNA
ATGTTGGTGTACCAAGATCTTCTCACCGGTGATGAGCTTCTGTCTGACTCTTTCCCTTACAAGGAGATTGAGAATGGAAT
CCTCTGGGAAGTAGAAGGAAAGTGGGTTACTGTGGGAGCTGTAGATGTTAACATTGGTGCCAATCCATCTGCTGAAGAAG
GTGGTGAGGATGAAGGTGTTGATGACTCTACTCAAAAGGTTGTTGACATTGTCGACACCTTCAGACTTCAGGAGCAACCA
ACTTATGACAAGAAGGGATTCATCGCTTACATTAAGAAATACATTAAGCTTTTGACACCCAAGCTCAGCGAAGAAGATCA
AGCTGTCTTCAAGAAGGGTATTGAGGGAGCTACCAAGTTTTTGCTCCCCAGGCTCAGTGACTTCCAATTCTTTGTTGGGG
AGGGTATGCATGATGACAGCACTTTGGTCTTTGCTTACTACAAGGAGGGTTCAACTAACCCAACATTTTTGTACTTCGCT
CATGGTTTGAAGGAGGTCAAGTGCTGA