Details for Arabidopsis Locus AT3G16620

Position : Chr3 ( 5`- 5658317 .. 5661963 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16620

Protein [Map View]
MGDGAEIVTRLYGDEKKLAEDGRISELVGSDEVKDNEEEVFEEAIGSQEGLKPESLKTDVLQEDFPLASNDEVCDLEETS
RNERGVENLKVNYSEIGESHGEVNEQCITTKEADSDLVTLKMNDYDHGEVADADISYGKMASSLDVVENSEKATSNLATE
DVNLENGNTHSSSENGVVSPDENKELVAEVISVSACSVETGSNGIDDEKWEEEIDVSAGMVTEQRNGKTGAEFNSVKIVS
GDKSLNDSIEVAAGTLSPLEKSSSEEKGETESQNSNGGHDIQSNKEIVKQQDSSVNIGPEIKESQHMERESEVLSSVSPT
ESRSDTAALPPARPAGLGRAAPLLEPAPRVTQQPRVNGNVSHNQPQQAEDSTTAETDEHDETREKLQFIRVKFLRLSHRL
GQTPHNVVVAQVLYRLGLAEQLRGRNGSRVGAFSFDRASAMAEQLEAAAQDPLDFSCTIMVLGKSGVGKSATINSIFDEL
KISTDAFQVGTKKVQDIEGFVQGIKVRVIDTPGLLPSWSDQHKNEKILKSVRAFIKKSPPDIVLYLDRLDMQSRDSGDMP
LLRTITDVFGPSIWFNAIVGLTHAASAPPDGPNGTASSYDMFVTQRSHVIQQAIRQAAGDMRLMNPVSLVENHSACRTNR
AGQRVLPNGQVWKPHLLLLSFASKILAEANALLKLQDNIPGGQFATRSKAPPLPLLLSSLLQSRPQAKLPEQQYDDEDDE
DDLDESSDSEEESEYDELPPFKRLTKAEMTKLSKSQKKEYLDEMEYREKLFMKRQMKEERKRRKLLKKFAAEIKDMPNGY
SENVEEERSEPASVPVPMPDLSLPASFDSDNPTHRYRYLDTSNQWLVRPVLETHGWDHDIGYEGVNAERLFVVKDKIPVS
FSGQVTKDKKDAHVQLELASSVKHGEGRSTSLGFDMQNAGKELAYTIRSETRFNKFRKNKAAAGLSVTLLGDSVSAGLKV
EDKLIANKRFRMVMSGGAMTSRGDVAYGGTLEAQFRDKDYPLGRFLSTLGLSVMDWHGDLAIGGNIQSQVPIGRSSNLIA
RANLNNRGAGQVSIRVNSSEQLQLAVVALVPLFKKLLTYYSPEQMQYGH*

DNA
ATGGGAGATGGGGCTGAGATTGTAACCAGGTTATATGGGGATGAGAAGAAGCTTGCAGAGGATGGTAGAATTAGTGAGTT
GGTGGGATCTGATGAAGTGAAGGATAATGAAGAAGAGGTCTTTGAGGAAGCAATTGGTTCGCAGGAGGGTCTAAAACCTG
AATCTCTCAAAACCGATGTGTTGCAAGAGGATTTTCCTTTAGCTTCCAATGATGAAGTGTGTGATTTGGAAGAAACAAGT
AGAAATGAGAGAGGAGTAGAAAATTTAAAGGTTAATTATTCGGAGATTGGAGAGAGCCATGGTGAGGTTAACGAGCAATG
TATAACTACGAAAGAGGCTGATTCTGATTTGGTGACTCTCAAAATGAATGATTATGATCACGGGGAAGTAGCAGATGCAG
ATATTTCTTATGGTAAAATGGCATCAAGCTTGGATGTGGTTGAGAACAGTGAGAAAGCTACTTCCAATTTAGCTACTGAG
GATGTGAATTTGGAAAACGGAAATACACATTCTTCTTCAGAAAATGGAGTAGTCTCTCCTGATGAGAATAAAGAACTGGT
GGCGGAAGTTATCTCAGTAAGTGCCTGTTCCGTGGAAACAGGGAGTAATGGTATTGACGACGAAAAATGGGAGGAAGAAA
TTGATGTATCAGCTGGCATGGTAACAGAACAAAGAAATGGTAAGACTGGTGCTGAGTTCAATAGTGTTAAAATTGTTTCA
GGTGACAAATCCTTGAATGATAGTATTGAAGTAGCAGCTGGGACCTTATCTCCATTGGAAAAATCTAGTTCGGAGGAGAA
GGGAGAGACTGAAAGTCAAAACAGTAATGGAGGACATGATATTCAATCTAATAAGGAAATTGTAAAGCAGCAAGATAGCA
GTGTAAATATAGGTCCAGAGATTAAGGAAAGCCAACATATGGAAAGAGAATCTGAGGTATTAAGTTCTGTTTCACCAACA
GAGTCTAGAAGTGATACTGCAGCATTACCACCTGCTCGCCCAGCAGGTCTTGGTCGTGCTGCTCCACTTTTGGAACCTGC
ACCACGCGTTACACAACAGCCTCGTGTCAATGGAAATGTGTCTCACAATCAGCCTCAGCAAGCTGAAGACTCTACCACTG
CAGAGACAGATGAGCATGATGAGACCCGTGAGAAGCTCCAGTTTATCAGGGTCAAATTTTTGAGGCTTTCACATAGATTA
GGGCAAACTCCACATAATGTTGTTGTTGCTCAGGTTTTGTACAGGCTTGGATTGGCTGAACAGTTGAGGGGCAGAAACGG
AAGCCGTGTTGGTGCCTTTAGTTTTGATCGTGCCAGTGCCATGGCAGAACAGCTTGAGGCAGCTGCACAAGATCCCCTTG
ATTTTTCTTGTACGATTATGGTGCTTGGTAAAAGTGGGGTTGGTAAAAGTGCAACCATCAATTCTATTTTTGATGAACTG
AAAATTAGTACTGATGCATTCCAGGTGGGGACAAAGAAGGTTCAGGATATTGAGGGTTTTGTTCAGGGAATTAAGGTACG
GGTAATTGACACTCCCGGTCTCTTACCATCCTGGTCAGATCAACACAAGAATGAGAAGATCCTGAAGTCTGTTAGGGCAT
TCATCAAGAAAAGTCCGCCTGACATTGTGTTATATCTTGATAGGTTGGATATGCAAAGCAGAGATTCTGGTGACATGCCT
CTCTTACGCACCATCACTGATGTTTTTGGACCATCAATATGGTTTAATGCCATTGTGGGTTTGACTCATGCCGCTTCGGC
TCCACCAGATGGCCCAAATGGTACTGCTTCTAGCTATGACATGTTTGTGACACAACGTTCTCATGTCATCCAGCAGGCCA
TTCGCCAAGCAGCGGGAGATATGAGGCTCATGAACCCTGTTTCTTTAGTTGAGAACCACTCTGCTTGCAGGACAAATCGG
GCAGGCCAGAGAGTATTACCTAATGGCCAAGTGTGGAAGCCTCATTTGTTATTACTCTCATTTGCATCCAAGATTCTTGC
CGAAGCAAATGCTCTTCTGAAATTACAAGATAATATTCCAGGGGGACAATTTGCAACTCGGTCCAAGGCTCCGCCACTAC
CATTGCTCCTCTCATCGCTTCTGCAATCAAGACCACAAGCTAAGCTTCCTGAGCAACAGTACGATGATGAAGACGATGAA
GATGATTTAGACGAATCATCAGATTCTGAGGAAGAATCAGAGTATGATGAGCTTCCTCCCTTTAAGCGGTTGACTAAAGC
AGAGATGACTAAGCTTAGCAAATCTCAGAAGAAGGAATATCTCGATGAGATGGAGTATCGGGAGAAACTATTTATGAAGA
GACAGATGAAAGAGGAAAGAAAGAGACGTAAGTTGTTGAAGAAATTTGCTGCTGAGATTAAAGATATGCCTAACGGGTAT
AGTGAAAATGTGGAAGAGGAGAGAAGTGAACCTGCATCTGTTCCAGTTCCAATGCCAGATTTATCTCTACCTGCATCTTT
TGACTCTGACAATCCTACTCATCGGTACCGGTACCTTGATACCTCCAATCAATGGCTTGTTAGGCCAGTGCTGGAAACTC
ATGGGTGGGATCATGATATTGGTTATGAAGGTGTGAATGCGGAACGACTATTTGTTGTTAAAGACAAAATACCAGTATCT
TTCTCTGGCCAAGTGACAAAGGACAAGAAGGATGCACATGTGCAGCTAGAATTGGCCAGCTCGGTTAAACATGGAGAAGG
TAGATCAACTTCCCTAGGTTTTGACATGCAAAATGCTGGGAAGGAATTAGCGTACACTATTCGAAGTGAAACAAGATTTA
ACAAGTTTAGGAAAAACAAAGCAGCAGCTGGTCTCTCTGTTACGCTCTTAGGTGATTCAGTTTCCGCGGGACTAAAAGTC
GAAGATAAGTTGATTGCTAATAAACGGTTCAGGATGGTTATGTCAGGTGGAGCAATGACTAGTCGTGGAGATGTTGCTTA
TGGTGGTACTTTAGAAGCTCAGTTTCGAGATAAAGATTATCCGCTTGGTCGGTTTTTATCAACTCTTGGACTCTCTGTGA
TGGATTGGCATGGCGATCTTGCTATCGGAGGGAATATACAGTCTCAAGTACCCATTGGACGTTCCTCTAATCTCATTGCT
CGTGCTAATCTGAATAACAGAGGAGCAGGGCAAGTAAGCATCCGCGTAAACAGCTCTGAGCAGCTTCAACTTGCTGTGGT
TGCACTTGTTCCTCTGTTCAAGAAGCTTCTTACTTATTATTCCCCTGAGCAAATGCAATATGGACACTGA