Details for Arabidopsis Locus AT3G16610

Position : Chr3 ( 5`- 5656371 .. 5658335 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16610

Protein [Map View]
MFLSLLETCIRSRNLVLGQVIHQHLLKRSLTLSSSTVLVNLTRLYASCNEVELARHVFDEIPHPRINPIAWDLMIRAYAS
NDFAEKALDLYYKMLNSGVRPTKYTYPFVLKACAGLRAIDDGKLIHSHVNCSDFATDMYVCTALVDFYAKCGELEMAIKV
FDEMPKRDMVAWNAMISGFSLHCCLTDVIGLFLDMRRIDGLSPNLSTIVGMFPALGRAGALREGKAVHGYCTRMGFSNDL
VVKTGILDVYAKSKCIIYARRVFDLDFKKNEVTWSAMIGGYVENEMIKEAGEVFFQMLVNDNVAMVTPVAIGLILMGCAR
FGDLSGGRCVHCYAVKAGFILDLTVQNTIISFYAKYGSLCDAFRQFSEIGLKDVISYNSLITGCVVNCRPEESFRLFHEM
RTSGIRPDITTLLGVLTACSHLAALGHGSSCHGYCVVHGYAVNTSICNALMDMYTKCGKLDVAKRVFDTMHKRDIVSWNT
MLFGFGIHGLGKEALSLFNSMQETGVNPDEVTLLAILSACSHSGLVDEGKQLFNSMSRGDFNVIPRIDHYNCMTDLLARA
GYLDEAYDFVNKMPFEPDIRVLGTLLSACWTYKNAELGNEVSKKMQSLGETTESLVLLSNTYSAAERWEDAARIRMIQKK
RGLLKTPGYSWVDV*

DNA
ATGTTTCTAAGTCTTCTTGAAACCTGTATTCGCTCAAGGAATCTGGTCTTAGGTCAGGTCATTCATCAGCATCTTCTTAA
ACGCTCTCTTACGTTAAGTTCCTCTACAGTGCTCGTCAATTTAACACGTCTTTACGCATCATGCAATGAAGTGGAACTTG
CACGCCATGTGTTCGATGAAATTCCTCATCCAAGGATCAATCCTATTGCTTGGGATTTGATGATCAGAGCCTATGCTTCG
AATGATTTCGCGGAAAAAGCTTTGGATTTGTACTACAAGATGCTGAATTCTGGTGTTAGACCCACGAAATATACGTACCC
GTTTGTTTTGAAAGCATGTGCTGGTCTTCGAGCAATTGACGATGGTAAGCTGATACATAGTCATGTGAATTGTAGCGACT
TTGCAACTGATATGTATGTATGTACTGCTCTGGTTGATTTCTATGCTAAGTGTGGGGAACTTGAGATGGCTATAAAGGTG
TTCGACGAAATGCCTAAGAGAGATATGGTTGCTTGGAATGCTATGATTTCTGGGTTTTCTTTACATTGCTGTTTAACTGA
TGTCATTGGATTGTTTTTGGATATGCGTAGAATCGATGGTCTGAGTCCTAATCTATCCACCATCGTTGGGATGTTTCCTG
CACTAGGAAGGGCTGGTGCATTGAGGGAAGGGAAAGCTGTTCATGGGTATTGCACAAGAATGGGTTTTAGCAATGATTTA
GTTGTTAAGACTGGGATCTTGGATGTATATGCCAAGAGCAAGTGCATTATCTATGCGAGAAGAGTTTTCGATTTAGACTT
TAAGAAGAATGAGGTAACCTGGAGTGCTATGATTGGAGGCTACGTAGAAAACGAAATGATAAAGGAAGCTGGAGAAGTGT
TTTTTCAGATGTTGGTTAATGATAATGTGGCAATGGTGACGCCAGTTGCCATTGGGCTTATTCTGATGGGTTGTGCAAGG
TTTGGAGATCTAAGTGGAGGGCGATGTGTACATTGTTACGCGGTTAAAGCAGGCTTCATCTTAGACTTAACTGTTCAAAA
CACCATAATTTCATTTTATGCTAAGTATGGAAGCTTATGTGATGCTTTTAGGCAGTTTAGTGAGATTGGCTTGAAAGATG
TTATTTCATATAATTCTCTCATCACTGGGTGTGTAGTGAACTGTCGCCCAGAAGAGAGTTTTCGTCTATTTCATGAGATG
AGAACATCTGGAATTCGTCCTGATATTACAACATTGCTTGGTGTCTTAACCGCTTGCTCTCACTTGGCTGCTTTGGGACA
CGGTTCTAGTTGCCACGGGTATTGTGTTGTTCATGGCTATGCAGTTAACACAAGCATTTGTAATGCACTGATGGATATGT
ACACAAAGTGTGGAAAACTTGATGTAGCCAAGAGAGTTTTCGACACAATGCATAAGCGGGATATAGTTTCGTGGAACACA
ATGCTGTTCGGATTCGGAATTCATGGTCTTGGCAAAGAAGCTCTTTCTCTGTTCAACAGTATGCAGGAAACAGGTGTGAA
CCCAGACGAGGTGACTCTTCTTGCTATTTTGTCTGCTTGTAGCCATTCAGGACTAGTGGATGAAGGGAAACAACTGTTCA
ACTCCATGTCTCGAGGAGATTTCAACGTCATCCCAAGAATAGACCATTACAATTGCATGACTGATCTTCTAGCCCGTGCC
GGATACTTGGATGAAGCTTATGATTTTGTAAACAAGATGCCATTTGAGCCCGATATTCGCGTGTTGGGTACACTTCTCTC
TGCTTGTTGGACGTACAAGAATGCGGAACTTGGGAATGAAGTGTCGAAAAAGATGCAGAGTCTTGGTGAAACAACAGAAA
GCTTAGTTCTTCTATCCAACACCTACTCAGCTGCTGAGAGATGGGAAGATGCAGCTAGAATTAGAATGATACAGAAGAAA
AGAGGGCTTCTCAAGACTCCGGGTTATAGCTGGGTCGATGTTTGA