Details for Arabidopsis Locus AT3G16590

Position : Chr3 ( 5`- 5649932 .. 5651056 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16590

Protein [Map View]
MPTKLPLELEDEILLRVPPLSLTRFRTVCKRWNTLFNDQRFINNHLACVRPQFILRTEKDSKIYSIGINIDDSLEVRELN
LETQGPNKKLKVYRNLFYCDGFLLCPALLDEVAVWNPWLRKQTKWIEPKRSRFNLYGLGYDNRRPEKCYKILGFGYGYSS
EINGSYNRINPRVSVFEFETNAWKDLKFGLFDWHLRSPRTVLSLNGTLYWIAVRCESGGDGFIQSFDFSREMFEPFCLLP
CKNDFGDTQILEVFRGDRLSVLEQCPTTNKIKIWVTKNKISGDRKELVSWRLLMTVSIPNFPRLQDLYSNSQPSYFMDNN
DDKRLIVCTCDESGKPCIYIVKGDRFKKIQMGFEVEPWPFHLVYVPSLVPIPLA*

DNA
ATGCCGACGAAGCTTCCACTGGAGTTGGAGGATGAGATACTTTTGCGTGTTCCACCTCTATCTCTCACACGCTTTAGAAC
AGTTTGCAAACGATGGAACACACTTTTCAACGATCAGAGATTCATCAACAATCACTTGGCTTGCGTCCGTCCTCAGTTCA
TATTACGGACCGAGAAAGATTCCAAGATCTATTCAATAGGCATCAATATCGATGACTCCTTAGAGGTGCGTGAGCTAAAC
CTAGAAACTCAAGGTCCTAATAAGAAGCTTAAGGTATATCGAAACCTCTTTTATTGCGATGGTTTTTTGTTATGTCCTGC
TTTGCTTGACGAGGTTGCTGTCTGGAATCCATGGTTGAGAAAACAAACTAAATGGATCGAGCCTAAGAGGAGTAGATTCA
ATTTATATGGACTAGGGTATGATAATCGTAGACCGGAGAAGTGTTACAAGATCTTAGGGTTTGGTTATGGTTACAGTAGT
GAAATAAACGGTAGTTACAACAGAATTAACCCGAGAGTTTCGGTATTTGAGTTTGAAACTAATGCGTGGAAGGATCTTAA
GTTTGGTTTATTTGATTGGCACCTAAGATCTCCCCGGACTGTTTTATCTTTGAATGGAACTTTGTATTGGATTGCTGTGA
GGTGTGAAAGTGGTGGTGATGGTTTTATCCAAAGCTTTGACTTTTCGAGGGAGATGTTCGAGCCCTTTTGTCTCTTGCCA
TGTAAGAACGATTTTGGCGATACTCAAATCCTTGAGGTTTTTAGGGGAGATCGGCTATCTGTGTTGGAACAATGCCCGAC
AACAAATAAGATCAAGATTTGGGTGACTAAGAACAAGATTAGTGGAGATAGGAAGGAGCTTGTGTCGTGGAGACTGTTAA
TGACAGTGTCGATACCAAACTTCCCGAGATTACAAGATCTTTACTCTAATTCTCAGCCGAGTTACTTCATGGATAACAAT
GATGACAAGAGGCTCATCGTGTGTACTTGTGATGAAAGTGGTAAGCCTTGCATATACATTGTGAAGGGGGATAGGTTCAA
GAAGATTCAAATGGGTTTTGAGGTTGAGCCTTGGCCTTTTCACCTTGTTTATGTTCCTAGTTTGGTTCCTATTCCTTTAG
CCTAA