Details for Arabidopsis Locus AT3G16580

Position : Chr3 ( 5`- 5647376 .. 5648746 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16580

Protein [Map View]
MAHEEKRPWEFSLSLPWELIEEILSRVPPESLLRFKTVSKQWNALFRDKTFINNHKMTFRFILATKSKIYSVSIDPKIVV
RELTLDIPGLESHEIPKKLVDCDKLLLCDMEKGVVLWNPWLRHSTWIDQGSNHTRMESYGIGYNNKGSYKIFAFCDRKEN
HTQRLLTIHDSASDAWKDREPIDNSQGKQIVHNIYTKISGVSLNGNLYLVTYFETTDLVYHLIEINSSSESVVKFCDLPC
GTSNFLKDAFVLRVFEGDRFSLLKQCHATKKIEIWVSKYKINNNLDRDVEWIKFMEVSSPNLPDLVDGFDSQPSYFIEDK
RLVVCSCNETGRAWIYVFGENKLISKTQIDSVVDLWPSHWTFIPSLVPVPRAQREEPAELQV*

DNA
ATGGCTCATGAGGAGAAGCGCCCATGGGAGTTTTCTTTATCTCTTCCATGGGAGTTGATTGAAGAGATACTCTCTCGTGT
CCCACCAGAATCTCTTCTTCGCTTCAAAACCGTATCGAAACAATGGAACGCTCTCTTCCGCGATAAGACGTTCATCAATA
ACCACAAGATGACGTTTCGATTCATCTTAGCAACCAAATCCAAGATTTATTCGGTAAGCATCGATCCCAAGATAGTTGTG
CGTGAGTTAACCTTAGATATTCCCGGTTTAGAATCTCATGAGATACCTAAAAAATTGGTTGATTGCGATAAGTTATTACT
ATGTGACATGGAGAAAGGAGTTGTGCTTTGGAACCCGTGGCTGAGACATAGTACATGGATCGACCAGGGTTCAAACCACA
CTCGAATGGAGTCTTATGGCATAGGATACAACAATAAGGGGAGTTACAAGATCTTTGCTTTTTGTGATCGGAAGGAAAAC
CACACCCAGAGATTGTTGACAATCCATGACTCTGCCTCTGATGCGTGGAAAGACCGCGAGCCTATTGATAATAGTCAGGG
AAAACAAATTGTTCATAACATATACACTAAAATTAGTGGTGTATCATTGAATGGAAATTTGTATTTGGTTACTTATTTTG
AAACGACTGATCTCGTGTACCACCTAATTGAAATCAATTCTTCGAGCGAAAGCGTCGTGAAGTTTTGTGATCTACCATGT
GGGACGTCGAACTTTCTTAAGGATGCTTTCGTCCTTAGGGTTTTCGAGGGAGATCGATTTTCATTGTTAAAGCAATGCCA
TGCAACAAAGAAGATTGAGATTTGGGTGAGCAAGTACAAGATTAATAATAATCTTGATAGAGATGTGGAATGGATAAAGT
TCATGGAAGTTTCAAGTCCTAACTTGCCGGATTTAGTAGATGGATTCGACTCTCAGCCAAGTTACTTTATTGAAGATAAA
AGGCTCGTCGTGTGCTCGTGCAACGAAACTGGTCGGGCTTGGATCTATGTTTTCGGAGAAAATAAGTTGATCAGTAAAAC
TCAAATTGATTCTGTGGTGGATCTTTGGCCTTCACACTGGACCTTTATTCCCAGTTTGGTACCGGTTCCTCGAGCTCAAA
GAGAAGAACCAGCAGAATTACAAGTTTGA