Details for Arabidopsis Locus AT3G16570

Position : Chr3 ( 5`- 5644698 .. 5645414 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16570

Protein [Map View]
MRGLSRNSGAAAIFAILLILAVHNWSVAVSSQSTEFAGDFPPFETECRGTIAECSVSAALGDGGDLFYGGGEMGEEFEMD
SEINRRILATRRYISYGALRRNTIPCSRRGASYYNCRRGAQANPYSRGCSAITRCRRS*

DNA
ATGAGAGGACTCTCCAGAAACTCCGGCGCGGCGGCGATATTCGCGATTCTACTCATTCTCGCCGTTCATAACTGGTCCGT
CGCCGTATCTTCTCAATCCACCGAATTCGCCGGAGATTTCCCTCCATTCGAAACAGAGTGCCGCGGTACAATTGCCGAGT
GCTCTGTTTCCGCCGCCCTCGGAGACGGAGGAGATCTATTCTACGGCGGAGGAGAAATGGGAGAGGAGTTCGAGATGGAC
TCAGAGATCAACCGGCGCATATTAGCTACGAGGAGGTACATCAGCTATGGTGCGCTGAGGAGAAACACAATTCCGTGCTC
ACGTCGCGGCGCATCTTACTACAATTGTCGACGTGGCGCTCAGGCCAATCCTTACTCTCGTGGCTGCAGCGCCATCACTC
GCTGCCGGCGCTCATGA