Details for Arabidopsis Locus AT3G16565

Position : Chr3 ( 5`- 5639839 .. 5642737 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16565

Protein [Map View]
MDFPPTKLDYHVDMFNLQSHSRFLSLFKAQDGRIALILESTVFHPQGGGQPSDTGLIVFSGSDLKFSVQDVRSKDGIVLH
YGVFEGSNPESGIDSEKGKEVYLTVDESRRKLNSRLHSAGHLLDMCMQKVGLGHLEPGKGYHFPDGPFVEYKGSVPQEEF
QVKQKELEAEANELISKGGKVYAAILPYEEASVLCGGSLPDYISKGSTPRIIKLGDSPGCPCGGTHVSNLSDIISMKITQ
MRTKKGMTKVFYTIAS*

DNA
ATGGATTTTCCTCCGACGAAGCTTGATTATCATGTAGACATGTTCAATCTTCAGTCTCATTCCAGATTTCTCTCCTTATT
TAAGGCGCAAGATGGACGCATAGCTCTAATACTAGAATCAACGGTGTTTCATCCACAAGGTGGTGGCCAGCCGTCAGACA
CCGGTTTAATTGTTTTCTCCGGTTCGGATTTGAAATTTTCCGTTCAAGATGTTCGATCGAAAGACGGAATTGTTCTCCAT
TACGGAGTTTTCGAAGGTTCGAATCCTGAAAGTGGAATTGATAGTGAGAAAGGGAAAGAAGTTTACTTAACTGTTGATGA
ATCAAGGCGTAAACTCAATTCCAGGTTGCACTCAGCTGGACACTTGCTAGATATGTGTATGCAGAAAGTTGGGTTAGGAC
ATTTGGAGCCTGGAAAAGGGTACCATTTTCCTGACGGTCCTTTTGTGGAATACAAAGGAAGCGTCCCACAGGAGGAGTTT
CAGGTGAAGCAGAAAGAGTTGGAGGCAGAAGCTAACGAACTGATATCCAAAGGAGGAAAGGTTTATGCTGCTATATTGCC
CTATGAAGAGGCATCTGTGCTCTGTGGTGGCAGTCTTCCTGATTATATTTCCAAGGGCAGCACTCCCCGGATCATAAAAT
TAGGTGACAGCCCCGGGTGTCCATGTGGTGGAACCCATGTCTCCAATTTATCCGATATCATAAGCATGAAGATCACACAG
ATGAGAACAAAGAAAGGAATGACGAAAGTTTTCTACACCATTGCATCTTGA