Details for Arabidopsis Locus AT3G16560

Position : Chr3 ( 5`- 5635596 .. 5638482 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16560

Protein [Map View]
MQEGTDPYGEIEISFGYQCNNKKIGIPEDKIADGREVLGGFRLQKTSSFSCLSGAALSGNPTLANTNICNGVIGSEILPS
LDSPKSFRKVPSSPALSKLDILSPSLHGSMVSLSCSSSTSPSPPEPESCYLTSMSSPSSVNEGFLLSAMEVQVAGGAAGE
DRVQAVCSEENGWLFCAIYDGFNGRDAADFLACTLYESIVFHLQLLDRQMKQTKSDDDGEKLELLSNISNVDYSSTDLFR
QGVLDCLNRALFQAETDFLRMVEQEMEERPDLVSVGSCVLVTLLVGKDLYVLNLGDSRAVLATYNGNKKLQAVQLTEDHT
VDNEVEEARLLSEHLDDPKIVIGGKIKGKLKVTRALGVGYLKKEKLNDALMGILRVRNLLSPPYVSVEPSMRVHKITESD
HFVIVASDGLFDFFSNEEAIGLVHSFVSSNPSGDPAKFLLERLVAKAAARAGFTLEELTNVPAGRRRRYHDDVTIMVITL
GTDQRTSKASTFV*

DNA
ATGCAGGAAGGGACTGATCCGTATGGTGAGATTGAGATAAGTTTTGGTTATCAATGCAATAATAAGAAGATAGGAATCCC
TGAAGATAAAATTGCTGATGGTCGTGAGGTTCTTGGTGGGTTTAGGCTACAAAAGACTAGCAGTTTCTCTTGTTTATCAG
GAGCTGCTTTAAGTGGAAACCCCACTTTAGCCAATACTAATATCTGCAATGGAGTCATTGGTTCTGAGATATTGCCGTCT
CTGGATTCTCCGAAATCTTTCAGGAAAGTTCCGTCTTCGCCTGCGCTTTCGAAGCTTGATATACTCTCTCCTTCTCTCCA
TGGAAGTATGGTGAGTCTAAGCTGCAGCTCGTCTACTAGTCCGAGTCCTCCTGAGCCTGAATCTTGTTACTTGACGTCAA
TGAGTTCTCCTTCTTCTGTTAATGAAGGGTTTCTTCTCTCTGCTATGGAAGTTCAAGTTGCGGGTGGTGCTGCAGGGGAA
GATAGAGTTCAAGCTGTTTGCTCTGAGGAGAATGGTTGGTTGTTTTGCGCTATCTATGATGGATTCAACGGAAGAGATGC
TGCTGATTTCTTGGCATGTACTTTATATGAGTCCATTGTGTTTCATCTTCAGTTGCTTGATCGTCAAATGAAGCAAACAA
AGTCCGATGATGATGGCGAAAAGTTGGAATTGTTATCAAATATAAGTAATGTAGATTACTCTTCCACTGATTTGTTCAGG
CAAGGAGTACTAGATTGCTTGAACCGTGCGCTTTTTCAGGCGGAAACCGATTTCCTAAGGATGGTTGAGCAAGAAATGGA
AGAAAGACCGGATTTAGTATCCGTTGGATCTTGTGTTTTGGTCACTCTCCTGGTTGGGAAGGATCTATACGTCCTTAATC
TTGGTGATAGCAGAGCTGTTCTAGCGACCTACAATGGTAATAAGAAGCTGCAAGCTGTTCAGCTCACAGAGGATCATACA
GTTGATAACGAAGTCGAAGAAGCTAGACTCTTAAGTGAGCATCTTGATGATCCTAAGATCGTTATTGGTGGGAAAATCAA
AGGAAAGCTTAAAGTTACTCGTGCTCTCGGAGTTGGTTACTTGAAGAAGGAGAAACTAAATGATGCACTCATGGGGATCC
TCCGCGTTCGTAACCTTTTGAGCCCGCCTTATGTTTCAGTGGAACCATCGATGAGAGTTCACAAGATAACGGAATCAGAT
CACTTTGTTATAGTTGCAAGCGATGGTTTGTTTGATTTCTTCAGCAACGAGGAAGCGATTGGGCTCGTCCATTCCTTCGT
TTCTAGTAATCCTTCTGGTGATCCAGCAAAGTTTCTGCTTGAACGTCTTGTAGCTAAAGCTGCTGCTCGTGCTGGCTTTA
CCTTGGAAGAATTGACGAATGTTCCGGCTGGTAGGAGAAGGAGATATCATGACGATGTGACTATAATGGTAATCACTCTA
GGTACCGATCAACGTACCTCAAAAGCTTCTACGTTCGTGTGA