Details for Arabidopsis Locus AT3G16510

Position : Chr3 ( 5`- 5616992 .. 5618294 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16510

Protein [Map View]
MANLTLELNVYSAKDLENVNLITKMDVYAVVWITGDDSRKNHKEKTPIDRTGESEPTWNHTVKFSVDQRLAHEGRLTLVV
KLVCDRIFGDKDLGEVQVPVLELLHGSSSPSSNGDGQGMMRFVTYQVRTPFGKGQGSLTFSYRFDSPTFKPDQPVSSHVF
HQDPPVSSSHVYTNPMDIPSDFSSATTNYPPPQSSEANFYPPLSSIGYPPSSPPQHYSSPPYPYPNPYQYHSHYPEQPVA
VYPPPPPSASNLYPPPYYSTSPPQHQSYPPPPGHSFHQTQPSQSFHGFAPSSPQNQHGYGYPPPTSPGYGYGCPTTQVPP
KNNNNKPGLGLGLGVGAGLLGGALGGLLISDIVSDIGFDF*

DNA
ATGGCGAATCTTACCTTAGAGCTCAACGTTTACTCAGCAAAAGATCTTGAAAATGTCAACCTCATCACAAAAATGGACGT
ATACGCCGTCGTTTGGATCACCGGCGATGATTCTCGGAAGAATCATAAGGAGAAAACCCCCATCGATCGCACCGGAGAAT
CTGAGCCTACTTGGAATCACACCGTCAAATTTTCCGTTGATCAAAGGTTAGCACACGAAGGTCGTTTAACCCTCGTCGTG
AAATTGGTCTGCGATCGGATCTTCGGCGACAAAGATCTCGGAGAGGTCCAAGTCCCGGTTCTTGAGCTTCTTCATGGTTC
TTCGTCGCCGTCATCTAACGGTGACGGTCAGGGGATGATGAGATTTGTTACGTATCAGGTCAGAACTCCGTTTGGAAAAG
GTCAAGGCTCGTTGACTTTTTCGTACCGGTTCGATTCACCGACATTTAAACCGGATCAACCGGTTTCATCACACGTTTTC
CACCAGGATCCACCGGTATCATCATCACACGTTTACACGAATCCGATGGATATACCGTCTGATTTCTCGTCGGCGACGAC
AAATTATCCTCCGCCGCAATCGTCTGAAGCAAATTTCTATCCACCATTATCATCGATTGGATATCCTCCGTCGTCTCCGC
CGCAACATTATTCCTCACCGCCGTACCCGTACCCGAACCCGTATCAGTACCATTCTCATTACCCGGAACAGCCAGTCGCT
GTTTATCCACCTCCGCCACCCTCTGCATCGAATTTATATCCTCCGCCGTATTACAGTACTTCTCCGCCGCAGCATCAATC
CTATCCGCCGCCTCCCGGCCATTCGTTCCACCAAACGCAACCGTCACAGTCGTTTCACGGGTTCGCGCCTTCGTCTCCGC
AGAATCAGCACGGGTATGGTTATCCGCCGCCGACGTCACCGGGATATGGATACGGTTGTCCGACTACACAAGTGCCGCCG
AAGAATAATAATAATAAACCAGGGCTTGGGCTTGGGCTTGGAGTGGGAGCTGGGCTTCTGGGAGGAGCATTGGGTGGGCT
CTTAATCAGTGATATAGTATCCGACATTGGTTTTGATTTTTAA