Details for Arabidopsis Locus AT3G16490

Position : Chr3 ( 5`- 5603900 .. 5605697 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16490

Protein [Map View]
MGRAARWFKGIFGMKKSKEKENCVSGDVGGEAGGSNIHRKVLQADSVWLRTYLAETDKEQNKHAIAVAAATAAAADAAVA
AAQAAVAVVRLTSNGRSGGYSGNAMERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLHSMQALIR
AQTSVRSQRINRNNMFHPRHSLERLDDSRSEIHSKRISISVEKQSNHNNNAYDETSPKIVEIDTYKTKSRSKRMNVAVSE
CGDDFIYQAKDFEWSFPGEKCKFPTAQNTPRFSSSMANNNYYYTPPSPAKSVCRDACFRPSYPGLMTPSYMANTQSFKAK
VRSHSAPRQRPDRKRLSLDEIMAARSSVSGVRMVQPQPQPQTQTQQQKRSPCSYDHQFRQNETDFRFYN*

DNA
ATGGGAAGAGCTGCGAGATGGTTCAAGGGTATTTTTGGTATGAAGAAGAGCAAAGAGAAAGAGAACTGTGTTTCCGGCGA
CGTTGGAGGTGAAGCCGGTGGTTCTAACATTCACCGGAAAGTTCTCCAAGCTGACTCCGTCTGGCTCAGAACTTACCTTG
CGGAAACAGACAAAGAACAGAACAAACACGCGATTGCGGTTGCTGCTGCTACAGCCGCGGCTGCTGACGCAGCGGTTGCA
GCGGCTCAAGCTGCTGTGGCGGTGGTCAGGTTAACAAGTAACGGAAGAAGCGGAGGATATTCCGGGAACGCAATGGAGCG
GTGGGCCGCAGTGAAAATTCAATCAGTCTTCAAGGGCTATTTGGCGAGAAAAGCGTTACGAGCTTTGAAAGGTTTAGTGA
AGCTACAAGCTTTGGTAAGAGGATACTTAGTCCGCAAACGCGCCGCCGAAACGCTGCATAGCATGCAAGCTCTCATTAGA
GCTCAAACCAGCGTCCGATCGCAACGCATCAACCGCAACAACATGTTTCATCCTCGACACTCACTTGAGAGGTTGGATGA
TTCAAGAAGTGAAATCCATAGCAAGAGAATATCAATCTCTGTAGAGAAACAGAGTAATCACAACAACAATGCGTACGATG
AGACCAGTCCCAAGATTGTGGAGATTGATACTTACAAGACGAAATCAAGATCAAAGAGAATGAATGTGGCTGTATCCGAA
TGTGGAGATGATTTCATCTATCAAGCCAAAGATTTCGAATGGAGTTTTCCGGGAGAGAAATGCAAGTTTCCTACGGCTCA
AAACACGCCGAGATTCTCTTCATCAATGGCTAATAATAACTATTACTACACGCCCCCATCGCCGGCGAAAAGTGTTTGCA
GAGACGCTTGTTTTAGGCCAAGTTATCCTGGTTTGATGACACCTAGCTATATGGCTAATACGCAGTCGTTTAAAGCCAAG
GTACGTTCGCATAGTGCACCGAGACAACGTCCTGATAGAAAAAGATTGTCACTTGATGAGATTATGGCGGCTAGAAGTAG
CGTTAGTGGTGTGAGGATGGTGCAACCACAACCACAACCGCAAACGCAAACGCAGCAACAGAAACGCTCTCCTTGTTCGT
ATGATCATCAGTTTCGTCAGAACGAGACTGATTTTAGATTCTATAATTAG