Details for Arabidopsis Locus AT3G16480

Position : Chr3 ( 5`- 5599778 .. 5602986 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16480

Protein [Map View]
MYRTAASRAKALKGILNHNFRASRYASSSAVATSSSSSSWLSGGYSSSLPSMNIPLAGVSLPPPLSDHVEPSKLKTTTLP
NGLTIATEMSPNPAASIGLYVDCGSIYETPQFRGATHLLERMAFKSTLNRSHFRLVREIEAIGGNTSASASREQMGYTID
ALKTYVPEMVEVLIDSVRNPAFLDWEVNEELRKVKVEIGEFATNPMGFLLEAVHSAGYSGALANPLYAPESAITGLTGEV
LENFVFENYTASRMVLAASGVDHEELLKVVEPLLSDLPNVPRPAEPKSQYVGGDFRQHTGGEATHFALAFEVPGWNNEKE
AIIATVLQMLMGGGGSFSAGGPGKGMHSWLYLRLLNQHQQFQSCTAFTSVFNNTGLFGIYGCTSPEFASQGIELVASEMN
AVADGKVNQKHLDRAKAATKSAILMNLESRMIAAEDIGRQILTYGERKPVDQFLKTVDQLTLKDIADFTSKVITKPLTMA
TFGDVLNVPSYDSVSKRFR*

DNA
ATGTACCGTACGGCAGCTTCTCGAGCCAAGGCCCTTAAGGGCATTCTAAACCACAATTTTCGAGCTTCTCGTTATGCAAG
TTCTAGTGCTGTTGCAACGAGCTCTTCTTCCTCCAGCTGGCTAAGTGGAGGCTACTCTAGTTCACTTCCTTCTATGAACA
TTCCCTTGGCTGGTGTCTCTCTTCCACCACCACTCTCTGACCATGTTGAGCCTAGCAAACTTAAGACCACTACTCTTCCA
AATGGTCTGACTATAGCCACTGAGATGTCTCCGAATCCAGCAGCTTCCATTGGTTTATACGTTGACTGTGGTTCTATTTA
TGAGACTCCTCAATTCCGTGGAGCGACGCACTTGCTTGAAAGGATGGCATTCAAGAGTACATTGAACAGAAGCCATTTTC
GCCTTGTAAGGGAAATAGAGGCTATTGGAGGTAATACTTCAGCTTCTGCATCCCGAGAGCAGATGGGTTACACAATTGAT
GCTCTCAAAACCTATGTTCCCGAAATGGTTGAAGTGCTTATTGATAGTGTGAGGAACCCTGCTTTTTTGGATTGGGAAGT
GAATGAAGAGCTCCGAAAGGTGAAAGTAGAGATAGGAGAATTCGCAACGAATCCAATGGGTTTTCTTTTGGAGGCAGTTC
ATTCTGCTGGTTACTCTGGCGCATTGGCAAATCCATTGTATGCACCTGAATCTGCAATTACTGGATTGACTGGGGAGGTC
TTGGAGAATTTTGTTTTTGAGAATTACACTGCTTCACGAATGGTCCTAGCAGCTAGTGGAGTTGATCATGAAGAACTTCT
AAAAGTGGTTGAGCCATTACTATCTGACCTCCCTAATGTACCCCGACCTGCGGAGCCAAAGTCTCAATATGTCGGTGGAG
ATTTCCGTCAACATACGGGTGGAGAGGCTACACATTTTGCGCTTGCTTTTGAAGTGCCAGGATGGAATAACGAGAAGGAA
GCTATCATTGCAACTGTTCTTCAGATGCTTATGGGAGGAGGTGGCTCATTTTCTGCGGGAGGCCCTGGAAAAGGAATGCA
CTCTTGGCTCTATCTTCGCCTTTTGAACCAACATCAGCAGTTTCAATCATGCACTGCATTCACTAGCGTCTTTAACAATA
CCGGATTGTTTGGAATCTATGGTTGCACGAGTCCTGAATTTGCTTCACAGGGAATTGAATTAGTAGCTAGTGAAATGAAC
GCTGTTGCTGATGGAAAAGTTAATCAGAAACATCTTGATCGCGCCAAAGCAGCAACAAAATCTGCGATTCTGATGAATCT
GGAATCTCGGATGATTGCAGCAGAAGACATTGGTAGACAGATTCTTACTTACGGAGAGAGGAAACCAGTAGACCAATTCT
TGAAGACAGTAGACCAACTTACCTTAAAGGACATTGCAGATTTCACTAGCAAGGTTATCACAAAGCCTTTGACAATGGCA
ACTTTCGGAGACGTGTTGAATGTTCCAAGCTATGACTCCGTAAGCAAAAGATTTCGCTGA