Details for Arabidopsis Locus AT3G16460

Position : Chr3 ( 5`- 5592582 .. 5595717 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16460

Protein [Map View]
MSWDDGSHAKVKKVQLTFDEIIYSIQVTYDGATALQSQLRGSVGPKSAEFTLAPDEYITALSAYGKSLSTQEVITALTFT
TNKTSYGPYGTKSGFQISAPEATGKQISGFLGTSGNVLNTIDVHYSPIPTGGTGTGGTGTGTGTGTGTGTGTGTGTGTGT
GTGTGTGGTGTGTGTGTGGTGTGTGTGGTGTGTGTGTGTGTGTGTGTGTGTGGTGTGTGTGGTGTGTGTGTGTGTGTGGT
GTGTGTGTGSGAQKLEAQGNSTGGTSWDDGSDYDGVTKIYASYGGEGIQYVKFDYVKGGVTKQGVLHGKQQSRQNPREFV
INHPDEYLVSVEGWYETVMLGIQFKTNLNTYEVSIYPFEPSTDTKFTLQVQDKKIIGFHGFAGNHVNSIGAYFVPKSSTT
PVPSTPLKLTAEGGETGAVWDDGSHDDVKKVYVGQGQDGVAAVKFEYKNGSQVVFGDERGTRTLLGFEEFELESDEYITS
VEGYYEKNFGVDTVVTTLIFKTSKNKTAGPFGIVSGTKFEFKKEGYKITGFHGRAGEYVNAIGAYLAPSGTTPLTPATQS
QKLEGAGSEAGTLWDDGAFDGVRKVSVGQAQDGIGAVSFVYDKAGQVVEGKEHGKPTLLGFEEFELDYPSEYITAVDGTY
DAIFGNEPIVNMLRFTTNKRVSIPFGIGAGTAFEFKKDGQKIVGFHGRAGDLLHKFGVHVAPITK*

DNA
ATGTCTTGGGACGATGGATCACACGCAAAGGTGAAGAAAGTGCAGCTAACCTTCGATGAGATCATCTACTCAATCCAGGT
CACGTACGACGGAGCCACCGCTCTTCAATCCCAGCTTCGCGGCTCCGTTGGTCCCAAATCTGCTGAGTTCACTTTGGCTC
CGGACGAGTACATAACGGCCCTTTCTGCTTACGGCAAATCGTTGAGTACGCAAGAAGTTATTACGGCGTTGACTTTCACA
ACCAACAAGACTTCTTATGGACCTTACGGTACCAAATCCGGTTTCCAGATTTCTGCTCCGGAAGCCACCGGTAAACAGAT
CTCCGGTTTCCTTGGTACCAGCGGCAATGTTCTCAACACCATCGACGTTCACTATTCTCCCATACCTACTGGAGGAACTG
GCACCGGAGGAACTGGCACCGGAACTGGCACCGGAACTGGCACTGGAACTGGCACTGGCACCGGAACTGGCACTGGAACT
GGCACTGGAACTGGCACCGGAGGAACTGGCACTGGAACTGGCACCGGTACTGGAGGAACTGGCACTGGAACTGGCACCGG
AGGAACTGGCACTGGAACCGGCACTGGGACTGGCACTGGAACCGGCACTGGGACTGGCACTGGAACCGGCACCGGAGGAA
CTGGCACTGGAACCGGCACCGGAGGAACTGGCACTGGAACCGGCACTGGGACCGGCACTGGGACCGGCACCGGAGGAACT
GGCACTGGAACCGGAACTGGTACCGGTTCAGGTGCTCAGAAATTGGAAGCACAAGGCAACAGTACAGGAGGTACATCATG
GGACGATGGATCCGATTACGATGGCGTGACCAAGATATACGCAAGCTACGGTGGGGAAGGTATTCAATACGTCAAGTTCG
ACTATGTGAAAGGTGGAGTAACAAAACAAGGAGTTCTACACGGTAAACAACAAAGTAGACAAAATCCAAGAGAGTTTGTG
ATTAACCATCCGGATGAGTATCTTGTTTCTGTTGAGGGTTGGTATGAAACCGTCATGCTAGGAATCCAGTTCAAAACGAA
CTTGAACACTTATGAGGTCAGCATCTATCCTTTCGAACCTAGTACTGATACTAAATTTACTCTTCAAGTTCAAGACAAGA
AGATCATTGGATTTCACGGTTTCGCGGGCAACCATGTTAATTCCATTGGAGCTTACTTCGTTCCAAAATCCTCCACCACT
CCTGTTCCTTCAACCCCTTTGAAGCTGACCGCAGAAGGTGGTGAGACAGGAGCTGTATGGGACGATGGTTCTCACGATGA
TGTTAAGAAAGTTTATGTAGGACAAGGCCAAGATGGTGTTGCAGCTGTCAAGTTTGAATACAAAAATGGTTCTCAGGTTG
TTTTTGGAGATGAACGTGGAACGAGAACATTGCTAGGATTCGAAGAGTTCGAGCTTGAATCAGACGAATATATAACATCC
GTGGAAGGATACTACGAAAAAAACTTTGGAGTTGATACTGTAGTGACAACGCTGATTTTCAAGACTAGCAAGAACAAAAC
AGCTGGACCGTTTGGGATTGTATCTGGCACAAAGTTTGAATTCAAGAAGGAAGGTTACAAGATCACTGGGTTCCACGGAC
GAGCTGGTGAGTATGTTAATGCTATTGGAGCTTATTTAGCTCCATCAGGCACCACCCCTTTGACTCCTGCAACACAATCC
CAAAAGCTAGAAGGAGCTGGTAGTGAGGCAGGAACTTTATGGGATGATGGTGCTTTCGACGGTGTAAGGAAAGTGTCTGT
AGGACAAGCCCAAGATGGTATTGGAGCGGTCTCGTTTGTGTACGACAAAGCAGGTCAGGTTGTAGAAGGAAAAGAACATG
GAAAACCCACATTGCTTGGATTTGAAGAGTTTGAGCTTGACTATCCAAGTGAATACATCACGGCAGTTGATGGCACCTAC
GATGCAATCTTTGGGAATGAACCAATCGTAAATATGCTTAGGTTCACGACTAATAAGCGAGTATCTATTCCTTTTGGAAT
AGGAGCTGGCACAGCCTTCGAATTCAAGAAGGACGGTCAAAAGATAGTTGGTTTCCATGGAAGAGCTGGTGATCTACTTC
ACAAATTTGGAGTCCATGTCGCGCCAATAACCAAATAA