Details for Arabidopsis Locus AT3G16380

Position : Chr3 ( 5`- 5558676 .. 5560993 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16380

Protein [Map View]
MALVKTETQALGNHQHSSRFGSLYVGDLSPDVTEKDLIDKFSLNVPVVSVHLCRNSVTGKSMCYAYINFDSPFSASNAMT
RLNHSDLKGKAMRIMWSQRDLAYRRRTRTGFANLYVKNLDSSITSSCLERMFCPFGSILSCKVVEENGQSKGFGFVQFDT
EQSAVSARSALHGSMVYGKKLFVAKFINKDERAAMAGNQDSTNVYVKNLIETVTDDCLHTLFSQYGTVSSVVVMRDGMGR
SRGFGFVNFCNPENAKKAMESLCGLQLGSKKLFVGKALKKDERREMLKQKFSDNFIAKPNMRWSNLYVKNLSESMNETRL
REIFGCYGQIVSAKVMCHENGRSKGFGFVCFSNCEESKQAKRYLNGFLVDGKPIVVRVAERKEDRIKRLQQYFQAQPRQY
TQAPSAPSPAQPVLSYVSSSYGCFQPFQVGTSYYYMGNQVPQMSGHQNITTYVPAGKVPLKERRSMHLVYKHPAYPVAKR
GAKQTLVFKGEVNRNLEAATCSKATTSEENRKEERRLTLSGKLSPEVKVEESGKQLQ*

DNA
ATGGCGCTCGTGAAAACGGAAACGCAGGCGTTAGGAAACCACCAGCATTCTTCAAGGTTTGGTTCGCTTTACGTCGGTGA
TCTTAGCCCAGACGTGACGGAGAAAGATCTCATTGATAAGTTCTCTTTGAATGTTCCGGTAGTGTCCGTTCATCTTTGCC
GTAACTCTGTCACCGGAAAATCCATGTGTTACGCTTACATCAACTTCGATTCACCTTTCAGCGCATCGAATGCTATGACT
CGCTTAAACCATAGTGATTTGAAGGGAAAGGCTATGCGAATAATGTGGTCTCAGAGGGATCTTGCGTACCGTCGTCGTAC
TCGTACTGGTTTTGCAAATCTATACGTAAAGAATCTGGATAGCTCGATTACTAGCAGTTGCTTAGAGCGAATGTTTTGCC
CCTTTGGTTCCATACTTTCTTGCAAAGTCGTTGAAGAGAATGGCCAAAGTAAAGGTTTTGGCTTTGTTCAGTTTGATACA
GAGCAATCTGCTGTATCTGCTCGTTCTGCTCTCCACGGCTCTATGGTTTATGGCAAGAAACTGTTTGTTGCCAAGTTCAT
CAACAAGGATGAAAGAGCAGCTATGGCAGGAAATCAAGACTCTACAAACGTTTATGTGAAGAATCTGATCGAAACTGTTA
CAGATGATTGTCTACATACACTGTTTTCTCAATATGGAACTGTCTCTAGTGTTGTGGTTATGAGGGATGGTATGGGAAGA
TCTAGAGGTTTCGGATTTGTTAACTTCTGCAATCCAGAAAATGCTAAGAAAGCTATGGAATCTCTCTGTGGACTACAACT
TGGATCGAAGAAATTGTTTGTTGGTAAGGCACTCAAGAAAGATGAAAGGAGGGAGATGCTGAAACAGAAATTCAGTGACA
ACTTTATTGCAAAGCCTAACATGAGATGGTCCAATCTGTACGTGAAGAACTTGAGTGAATCAATGAATGAAACAAGACTG
CGAGAAATCTTTGGATGCTATGGGCAAATAGTTTCAGCTAAAGTGATGTGTCATGAGAATGGCAGAAGTAAAGGATTCGG
CTTTGTGTGCTTCTCTAACTGTGAAGAGTCCAAACAGGCTAAAAGATATCTCAATGGGTTCTTAGTTGATGGAAAGCCAA
TAGTTGTTCGAGTTGCAGAGCGCAAAGAGGATCGAATCAAGAGGTTGCAGCAATATTTTCAGGCACAGCCACGCCAGTAC
ACGCAAGCTCCTTCTGCCCCTTCACCAGCTCAGCCAGTCCTCTCATATGTGTCCAGCTCATATGGTTGCTTTCAGCCATT
CCAGGTCGGGACATCTTATTACTATATGGGCAATCAGGTGCCACAAATGTCCGGTCACCAAAACATCACCACCTACGTTC
CAGCTGGGAAAGTGCCTCTCAAGGAGAGAAGATCAATGCATCTGGTCTACAAACATCCGGCTTATCCCGTTGCCAAGAGG
GGTGCTAAACAGACACTGGTTTTTAAGGGTGAGGTTAACAGAAATTTAGAGGCTGCAACATGCTCCAAAGCAACAACATC
TGAGGAGAACCGTAAAGAAGAACGAAGATTGACTTTGTCAGGAAAGTTGTCACCAGAAGTGAAGGTAGAGGAATCAGGAA
AACAATTGCAATGA