Details for Arabidopsis Locus AT3G16350

Position : Chr3 ( 5`- 5547718 .. 5549660 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16350

Protein [Map View]
MTRRCSHCSNNGHNSRTCPTRGGGTCGGSGGGGGGGGGGGSGSSSAVKLFGVRLTDGSIIKKSASMGNLSALAVAAAAAT
HHRLSPSSPLATSNLNDSPLSDHARYSNLHHNEGYLSDDPAHGSGSSHRRGERKRGVPWTEEEHRLFLVGLQKLGKGDWR
GISRNYVTSRTPTQVASHAQKYFIRHTSSSRRKRRSSLFDMVTDEMVTDSSPTQEEQTLNGSSPSKEPEKKSYLPSLELS
LNNTTEAEEVVATAPRQEKSQEAIEPSNGVSPMLVPGGFFPPCFPVTYTIWLPASLHGTEHALNAETSSQQHQVLKPKPG
FAKERVNMDELVGMSQLSIGMATRHETETSPSPLSLRLEPSRPSAFHSNGSVNGADLSKGNSAIQAI*

DNA
ATGACTCGTCGGTGTTCGCATTGTAGCAACAATGGGCACAATTCACGCACGTGTCCAACGCGTGGTGGTGGCACGTGCGG
TGGAAGTGGCGGAGGAGGAGGAGGTGGTGGTGGAGGAGGGTCTGGTTCCTCCTCCGCCGTGAAGTTATTTGGTGTGAGGT
TAACGGATGGCTCGATTATTAAAAAGAGTGCGAGTATGGGTAATCTCTCGGCATTGGCTGTTGCGGCGGCGGCGGCAACG
CACCACCGTTTATCTCCGTCGTCTCCTCTGGCGACGTCAAATCTTAATGATTCGCCGTTATCGGATCATGCCCGATACTC
TAATTTGCATCATAATGAAGGGTATTTATCTGATGATCCTGCTCATGGTTCTGGGTCTAGTCACCGTCGTGGTGAGAGGA
AGAGAGGTGTTCCTTGGACTGAAGAGGAACATAGACTATTCTTAGTCGGTCTTCAGAAACTCGGGAAAGGAGATTGGCGC
GGTATTTCGAGAAACTATGTAACGTCAAGAACTCCTACACAAGTGGCTAGTCATGCTCAAAAGTATTTTATTCGACATAC
TAGTTCAAGCCGCAGGAAAAGACGGTCTAGCCTCTTCGACATGGTTACAGATGAGATGGTAACCGATTCATCGCCAACAC
AGGAAGAGCAGACCTTAAACGGTTCCTCTCCAAGCAAGGAACCTGAAAAGAAAAGCTACCTTCCTTCACTTGAGCTCTCA
CTCAATAATACCACAGAAGCTGAAGAGGTCGTAGCCACGGCGCCACGACAGGAAAAATCTCAAGAAGCTATAGAACCATC
AAATGGTGTTTCACCAATGCTAGTCCCGGGTGGCTTCTTTCCTCCTTGTTTTCCAGTGACTTACACGATTTGGCTCCCTG
CGTCACTTCACGGAACAGAACATGCCTTAAACGCTGAGACTTCTTCTCAGCAGCATCAGGTCCTAAAACCAAAACCTGGA
TTTGCTAAAGAACGTGTGAACATGGACGAGTTGGTCGGTATGTCTCAGCTTAGCATAGGAATGGCGACAAGACACGAAAC
CGAAACTTCCCCTTCCCCGCTATCTTTGAGACTAGAGCCCTCAAGGCCATCAGCGTTTCACTCGAATGGCTCGGTTAATG
GTGCAGATTTGAGTAAAGGCAACAGCGCGATTCAGGCTATCTAA