Details for Arabidopsis Locus AT3G16330

Position : Chr3 ( 5`- 5535196 .. 5536063 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16330

Protein [Map View]
MEKNISISKKLGNIVRFVLYMLHKGISKQKLLADFNATLKRGKNLMFHNRRRVPGSAVASHPQNEYEFSCSDTPNYTFPF
NMAAFKKKSHHNSLFSCGQAPPTLDDDTSVSRAVLELLNSGGDHDQGSNTPAFSIEALTALSPYLPGFGRSTSSVRPLRV
TDSPFPLREEGDVANGHVDKAADEFIKKFYKNLYQQKKMIESSPN*

DNA
ATGGAGAAGAATATATCAATAAGCAAGAAGCTAGGGAACATTGTACGTTTTGTCTTGTACATGTTACACAAAGGCATTTC
TAAGCAAAAGCTCCTAGCCGACTTTAATGCCACTCTCAAACGCGGCAAGAATCTCATGTTCCACAACCGCCGCCGTGTCC
CAGGCTCGGCTGTTGCGTCCCATCCACAGAACGAGTACGAGTTTAGCTGCAGCGACACTCCTAACTACACGTTCCCCTTC
AACATGGCTGCCTTCAAGAAGAAGAGCCACCACAACAGCCTCTTCTCCTGTGGTCAAGCGCCACCGACCCTTGATGACGA
CACTTCCGTCTCCAGAGCCGTTCTAGAGCTGCTCAACAGCGGTGGAGATCATGATCAGGGAAGTAACACGCCGGCTTTTT
CCATTGAGGCCTTGACGGCGTTATCTCCCTACCTGCCGGGATTTGGACGGAGTACTTCGTCCGTGAGGCCTTTACGGGTA
ACGGACTCACCATTCCCGTTAAGAGAAGAGGGTGACGTGGCTAACGGACATGTGGACAAGGCAGCGGATGAGTTTATAAA
GAAGTTTTACAAGAACTTGTATCAGCAAAAGAAGATGATTGAGTCCTCACCTAATTAA