Details for Arabidopsis Locus AT3G16310

Position : Chr3 ( 5`- 5526414 .. 5528602 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16310

Protein [Map View]
MSAAAHRTPKSGRQSLLFQDLASPVSARRGKFSSPGQAAAVSALWRENFGGSDLPPPPMYTLDDRSDFSPESGIADYSAS
PDAKSDRRTPFQSSGKNIVTPGKGKLEASPSFSLLNAQQSQQVSGSPSWWSQSKAGSSTEQDDKGKGSPVEGVVQPGALV
TLPPPREVARPEVQRQIIPTGNLDEEEWVTVYGFSPGDTNLVLREFEKCGMVLKHVPGPRNANWMHILYQNRSDAHKALN
KAGMMINGVVIVGVKPVDPIQKQALNERLNNQGFMPLPPPSSTRNTARPLSRPQYLQNGSAFSPQPSGGAMASPSKSMVS
KFFDLMFGV*

DNA
ATGAGTGCTGCAGCACACAGGACTCCTAAATCAGGGAGGCAATCTCTGCTATTTCAAGATTTAGCTTCTCCTGTTTCAGC
ACGTAGAGGGAAATTCTCGAGTCCGGGACAGGCAGCTGCGGTATCTGCACTATGGCGTGAGAATTTCGGAGGATCTGATC
TTCCACCACCTCCAATGTATACTTTGGATGACCGGTCCGATTTCTCTCCTGAGTCTGGTATTGCAGACTACTCTGCGTCT
CCAGATGCTAAGTCTGACAGAAGAACACCATTCCAGAGTTCTGGAAAGAATATTGTAACTCCTGGTAAAGGAAAGTTGGA
AGCAAGCCCTTCTTTTTCTCTACTGAATGCACAACAGAGTCAGCAAGTTTCAGGGAGTCCGAGTTGGTGGTCGCAGTCAA
AGGCAGGTAGTAGTACCGAGCAGGATGATAAAGGGAAGGGATCTCCTGTAGAAGGGGTGGTTCAGCCAGGTGCATTGGTC
ACTCTTCCGCCGCCAAGAGAAGTTGCTAGGCCAGAGGTTCAGAGGCAGATTATACCTACAGGAAACCTTGATGAGGAAGA
GTGGGTCACTGTCTATGGATTTTCTCCAGGTGATACAAATTTAGTACTACGGGAGTTTGAAAAATGTGGTATGGTCTTGA
AACATGTTCCTGGTCCAAGAAATGCCAACTGGATGCACATCCTCTACCAGAACCGGTCTGATGCACATAAGGCGCTGAAC
AAAGCAGGGATGATGATAAACGGAGTTGTAATAGTAGGAGTGAAGCCAGTAGACCCAATACAGAAGCAAGCGTTAAACGA
GAGACTCAACAACCAAGGATTCATGCCTTTACCTCCACCATCATCCACTAGAAACACTGCTCGACCCCTGTCTCGTCCTC
AGTACTTGCAAAACGGCAGCGCTTTCTCTCCTCAACCAAGTGGTGGCGCTATGGCCTCTCCGTCAAAGTCAATGGTCTCA
AAGTTCTTTGACTTGATGTTCGGTGTTTAA