Details for Arabidopsis Locus AT3G16290

Position : Chr3 ( 5`- 5521071 .. 5524995 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16290

Protein [Map View]
MACRFPLHSSSPSQFLSPENRQRLPRNYPSISCQNNSATNVVHEDGDDNDKAKTNQVNLLAIPITLTIISASLAKPSFAA
AKVTERKRTQKKPQEALTLEQLKAWSKDLPVVSNRIPYTDILSLKAEGKLKHVIKPPNLSLRQKAEPVLVVLEDSRVLRT
VLPSLEGNKRFWEQWDELGIDVQCVNAYTPPVKRPPVPSPYLGFLWKVPAYMLTWVKPKKESKRAAELKRMREDFKRQRK
EEIETMKEERVMMEKTMKAQKKQQERKKRKAVRKKKYEESLREARKNYRDMADMWARLAQDPNVATALGLVFFYIFYRVV
VLNYRKQKKDYEDRLKIEKAEADERKKMRELEREMEGIEEEDEEVEEGTGEKNPYLQMAMQFMKSGARVRRASNKRLPEY
LERGVDVKFTDVAGLGKIRLELEEIVKFFTHGEMYRRRGVKIPGGILLCGPPGVGKTLLAKAVAGEAGVNFFSISASQFV
EIYVGVGASRVRALYQEARENAPSVVFIDELDAVGRERGLIKGSGGQERDATLNQLLVSLDGFEGRGEVITIASTNRPDI
LDPALVRPGRFDRKIFIPKPGLIGRMEILQVHARKKPMAEDLDYMAVASMTDGMVGAELANIVEIAAINMMRDGRTELTT
DDLLQAAQIEERGMLDRKDRSLETWRQVAINEAAMAVVAVNFPDMKNIEFLTINPRAGRELGYVRVKMDHIKFKEGMLSR
QSILDHITVQLAPRAADELWYGEDQLSTIWAETSDNARSAARSLVLGGLSDKHHGLNNFWVADRINDIDVEALRILNMCY
ERAKEILGRNRTLMDEVVEKLVQKKSLTKQEFFTLVELYGSSKPMPPSILELRKIKRLELEEMVLKLDMTTARNSS*

DNA
ATGGCTTGTCGTTTCCCTCTGCATTCTTCGTCACCTTCTCAATTCCTTTCACCGGAAAATCGTCAGAGACTACCCAGAAA
TTACCCTTCAATCTCATGCCAAAACAATTCAGCTACGAACGTTGTCCATGAAGATGGTGATGATAACGACAAAGCCAAGA
CAAACCAAGTCAATCTTCTCGCAATACCAATCACACTCACTATAATCTCCGCTTCTCTAGCCAAACCGTCGTTCGCGGCT
GCGAAGGTAACGGAGAGAAAGAGAACTCAGAAGAAACCTCAGGAGGCTTTGACACTTGAACAGCTTAAAGCTTGGTCCAA
AGATTTACCTGTAGTTTCGAATCGTATACCTTATACTGACATTTTGAGCTTAAAAGCTGAAGGTAAGCTTAAGCATGTGA
TAAAGCCTCCTAATTTAAGTTTGCGGCAAAAGGCAGAGCCTGTGTTAGTAGTTTTGGAGGATTCTAGAGTATTAAGGACT
GTGTTGCCTTCTTTAGAGGGTAATAAGAGGTTTTGGGAACAATGGGATGAGTTAGGGATTGATGTACAATGTGTTAATGC
TTATACTCCTCCGGTTAAGAGACCTCCTGTGCCGTCTCCTTATTTAGGATTTTTGTGGAAAGTTCCTGCTTATATGTTAA
CATGGGTTAAGCCAAAGAAGGAGTCTAAACGTGCTGCTGAGTTGAAGAGAATGAGGGAGGATTTCAAGAGGCAGAGGAAG
GAGGAGATTGAGACGATGAAAGAGGAAAGAGTGATGATGGAAAAGACAATGAAGGCGCAGAAGAAACAACAGGAGAGGAA
GAAAAGGAAGGCTGTTAGGAAGAAGAAATACGAGGAGTCTCTGCGTGAGGCGAGGAAAAATTATCGAGATATGGCGGATA
TGTGGGCAAGATTGGCTCAGGATCCTAATGTGGCTACTGCTCTTGGATTGGTATTCTTTTATATATTTTACCGTGTGGTG
GTTCTCAACTATAGGAAGCAAAAGAAGGATTATGAAGACAGGTTGAAGATTGAGAAGGCGGAAGCAGATGAGAGGAAGAA
AATGAGGGAGTTGGAAAGGGAGATGGAGGGAATTGAGGAAGAGGATGAGGAGGTTGAGGAAGGTACAGGTGAGAAAAATC
CTTACTTACAGATGGCGATGCAGTTCATGAAGTCAGGTGCACGTGTGAGACGAGCATCAAATAAGAGGTTACCTGAGTAT
CTTGAGAGAGGTGTGGATGTCAAATTTACAGATGTTGCTGGACTTGGGAAGATTCGTCTTGAACTTGAGGAAATCGTTAA
GTTTTTTACTCATGGAGAGATGTACCGCAGGAGAGGGGTCAAGATTCCAGGTGGTATTCTTTTATGTGGGCCTCCTGGGG
TCGGAAAAACTTTACTGGCAAAAGCTGTAGCTGGTGAAGCAGGAGTCAATTTCTTCTCTATCTCTGCTTCTCAGTTTGTG
GAAATATATGTTGGTGTTGGTGCATCTCGTGTCCGAGCATTATACCAAGAAGCTAGAGAAAATGCTCCATCTGTGGTCTT
CATTGATGAATTGGATGCTGTTGGAAGGGAGCGTGGGTTAATAAAGGGTTCTGGAGGACAAGAAAGGGATGCCACTCTTA
ATCAGCTACTTGTTTCTTTAGATGGTTTTGAAGGAAGGGGAGAGGTCATCACCATTGCTTCCACAAACAGACCAGACATT
CTCGATCCTGCGCTTGTGAGGCCTGGACGGTTCGACCGCAAAATCTTTATCCCTAAACCTGGTCTTATTGGACGGATGGA
AATTCTGCAGGTTCATGCTCGTAAGAAGCCGATGGCTGAAGATTTAGACTATATGGCAGTTGCTAGCATGACAGATGGCA
TGGTTGGAGCAGAGCTTGCTAATATTGTTGAGATCGCGGCAATTAATATGATGCGTGATGGAAGAACAGAGTTAACAACA
GATGATTTGCTTCAAGCTGCACAAATAGAAGAAAGAGGAATGTTAGATAGAAAAGACAGGAGCTTGGAGACATGGCGACA
AGTTGCGATCAATGAAGCTGCAATGGCTGTTGTAGCAGTGAACTTTCCTGATATGAAGAATATAGAATTTCTGACAATCA
ACCCTAGAGCTGGTAGAGAATTGGGTTATGTCCGGGTGAAGATGGATCATATCAAATTTAAGGAAGGCATGCTTAGTCGA
CAATCCATCTTGGATCACATCACTGTTCAGTTAGCACCCCGTGCTGCAGATGAACTATGGTACGGTGAGGATCAGTTAAG
CACGATATGGGCTGAAACATCGGATAACGCAAGATCAGCTGCTCGATCATTGGTTCTTGGTGGTCTTTCTGATAAGCATC
ATGGCTTGAATAACTTCTGGGTAGCTGATCGAATTAACGATATTGATGTGGAGGCATTGCGGATATTGAACATGTGTTAC
GAGCGTGCTAAAGAGATTCTTGGAAGAAACAGGACGCTCATGGACGAGGTGGTAGAGAAACTGGTTCAAAAGAAAAGTCT
AACGAAACAAGAATTCTTCACTCTTGTTGAGCTCTATGGGTCCAGTAAACCAATGCCACCGAGTATCCTTGAACTTAGGA
AGATCAAACGGCTTGAGCTAGAAGAGATGGTGCTGAAACTGGACATGACTACCGCAAGAAACAGTTCATAA