Details for Arabidopsis Locus AT3G16280

Position : Chr3 ( 5`- 5518331 .. 5519246 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16280

Protein [Map View]
MTSLNSSASPTSSSSDQSDATTTTSTHLSEEEAPPRNNNTRKRRRDSSSASSSSSMQHPVYRGVRMRSWGKWVSEIRQPR
KKTRIWLGTFVTADMAARAHDVAALTIKGSSAVLNFPELASLFPRPASSSPHDIQTAAAEAAAMVVEEKLLEKDEAPEAP
PSSESSYVAAESEDEERLEKIVELPNIEEGSYDESVTSRADLAYSEPFDCWVYPPVMDFYEEISEFNFVELWSFNH*

DNA
ATGACGTCACTCAACAGCTCTGCATCACCAACATCATCGTCATCAGACCAATCTGATGCAACTACTACAACAAGCACCCA
CTTGTCTGAAGAAGAAGCTCCACCCAGAAACAACAACACAAGAAAGAGAAGGAGAGATTCTTCTTCTGCTTCTTCATCTT
CTTCAATGCAACATCCTGTTTACAGAGGTGTGCGGATGAGAAGTTGGGGCAAATGGGTCTCCGAGATCCGACAACCTCGT
AAGAAAACTCGTATTTGGCTCGGCACTTTTGTCACCGCTGATATGGCTGCTCGTGCTCACGACGTCGCTGCTCTCACCAT
CAAAGGCTCCTCCGCCGTCTTAAATTTCCCTGAGCTTGCTTCTCTCTTCCCTCGTCCGGCGTCATCATCGCCGCATGATA
TCCAGACAGCCGCCGCAGAAGCCGCCGCCATGGTGGTCGAAGAAAAACTGTTAGAGAAGGATGAGGCTCCGGAGGCCCCA
CCTTCGTCGGAATCTTCTTACGTGGCGGCGGAGTCAGAGGATGAGGAGAGGTTGGAGAAAATTGTGGAGCTGCCTAACAT
TGAAGAAGGAAGTTATGACGAGAGTGTGACATCACGTGCTGATCTGGCTTATTCTGAGCCGTTCGATTGTTGGGTGTATC
CTCCGGTTATGGATTTTTATGAAGAAATATCGGAGTTTAATTTCGTGGAATTGTGGAGCTTTAATCACTAA