Details for Arabidopsis Locus AT3G16230

Position : Chr3 ( 5`- 5500178 .. 5503545 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G16230

Protein [Map View]
MFAYRTLFRIDRVFGFTSRCFQSKPESFSILSFRGSEKSAMDGYKKQKMVNLVWRPISTQTSSVIAEAGNEVQEVAQCSK
SSDVSKEVIEGETASVVSAGKHSVSLEVGASLIKFIRGKEGTTQMKLEEEMGVKIILPSSRNKDHISIEGGSVDCVTKAS
KRIATIIDEVVRSPSLDYSHFVSLPLAIHPELVDKLVNFQNSILGIHSIASDKQDDQANRATTSVAVDLKANSETNQVNV
GIKSIPIVSYPPKAKSKSSTLLDLGIEKSIFIKPSTFHLTVVMLKLWNKDRVNAACDVLKSIFPSVMDALDNKPVFIRLK
GLDCMRGPLDKTRVLYAPVEEIGDEGRLLRACQVITDAFVKAGLVLEKDAKQSLKLHVTVMNARHRKRRKNNKKKMETFD
AREIHKQFGNEDWGEYLIQEAHLSQRFVFDQNGYYRCCGSIPFPGEQRA*

DNA
ATGTTCGCTTACAGGACTCTGTTTAGGATTGACCGTGTATTTGGGTTTACGAGTAGATGTTTTCAATCGAAACCGGAATC
TTTTAGTATCCTGAGCTTTAGGGGAAGTGAGAAGAGTGCCATGGATGGATATAAGAAGCAGAAGATGGTAAATTTAGTGT
GGAGACCCATCTCCACTCAAACCTCTTCAGTTATTGCTGAAGCTGGAAATGAAGTCCAAGAAGTAGCTCAGTGTAGCAAA
TCAAGTGATGTTTCTAAGGAAGTTATTGAAGGAGAGACAGCTTCAGTTGTTTCAGCTGGAAAGCATTCAGTTTCTCTTGA
GGTTGGGGCTTCTTTGATTAAGTTCATTAGAGGGAAAGAAGGAACGACGCAGATGAAACTTGAAGAGGAAATGGGAGTGA
AGATCATTCTTCCATCATCAAGGAACAAAGATCATATCAGCATTGAAGGCGGTTCAGTGGATTGTGTGACTAAAGCTTCA
AAAAGAATAGCAACCATTATCGATGAGGTTGTAAGGAGTCCAAGTCTCGACTACTCACACTTTGTATCACTTCCATTAGC
CATACATCCTGAGTTAGTGGACAAGCTAGTGAATTTTCAGAATTCTATCCTCGGGATCCATAGCATAGCTAGTGATAAGC
AAGACGACCAAGCTAATAGAGCAACCACAAGTGTGGCAGTTGATCTAAAAGCTAATAGTGAAACAAACCAGGTCAATGTG
GGTATCAAGAGCATACCAATTGTCAGTTACCCGCCTAAGGCCAAATCAAAGTCATCTACTTTATTGGACTTAGGAATTGA
AAAGTCCATATTTATTAAGCCAAGTACTTTTCACTTGACTGTGGTTATGCTGAAGTTATGGAACAAAGATCGTGTCAATG
CAGCGTGTGATGTTCTGAAGAGTATATTTCCTAGTGTGATGGATGCTTTGGATAACAAACCAGTATTCATTAGACTTAAA
GGATTGGATTGTATGAGAGGACCATTAGACAAGACTCGTGTTCTCTATGCTCCTGTTGAAGAAATTGGTGATGAAGGCCG
GCTTTTACGTGCTTGTCAAGTTATTACTGATGCATTTGTGAAAGCTGGGCTTGTTCTCGAGAAAGATGCAAAGCAAAGCT
TGAAGCTGCATGTGACCGTGATGAATGCGAGGCACAGGAAAAGGAGAAAGAACAATAAGAAGAAGATGGAGACGTTTGAT
GCAAGAGAGATACACAAACAGTTTGGAAACGAAGACTGGGGAGAATATCTGATCCAAGAAGCTCATCTCTCACAGCGTTT
TGTGTTCGACCAGAACGGTTATTACCGTTGCTGTGGTTCAATACCATTTCCAGGAGAACAGAGAGCCTGA